PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07219.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 340aa    MW: 36777.1 Da    PI: 5.2179
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07219.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.19.3e-091521911352
                                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                                     NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  Zmw_sc07219.1.g00030.1.sm.mkhc 152 NRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 191
                                     *********************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-7144204IPR004827Basic-leucine zipper domain
CDDcd147034.99E-21149194No hitNo description
SuperFamilySSF579592.46E-9149195No hitNo description
PfamPF001707.4E-7151190IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-7151198No hitNo description
PROSITE profilePS502179.036152205IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
SEVAFRFPDD LDLGGCGGPG GDGLNEISSE VDLFSTFMDI EKISSAGPAE SSSPPHPKHR  60
HSTSVDGSGL FFSTGSGGGS AASLADVLEA KKAMSPEQLA ELAAIDPKRA KRCCLLDLSP  120
ILTDLPTTIV RPQLASDLTY FPLNDAAEIL ANRQSAARSK ERKARYITEL ERKVQTLQTE  180
ATTLSAQLTL FQRDTTGLSA ENAELKISLQ AMEQQAQLRD ALNDALKQEL ERLKLATGEA  240
TNSDEMYNMR FHHLPCNSSF FPLSQQNTAQ HQGGAQLPPA FHLPHHNVPN YQILSHPNTR  300
QDIMQQDSIG RFQGLDIGKG PLVVKSESSS ISASESSSTF
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795608.11e-151transcription factor RF2b
SwissprotQ6S4P41e-133RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A2S3IQW41e-150A0A2S3IQW4_9POAL; Uncharacterized protein
STRINGSi036380m1e-146(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]