PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07059.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 142aa    MW: 15990.3 Da    PI: 10.5126
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07059.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA572.7e-182660135
                            GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                                    C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++
  Zmw_sc07059.1.g00030.1.sm.mkhc 26 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 60
                                    ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577163.28E-141859No hitNo description
PROSITE profilePS5011412.4792056IPR000679Zinc finger, GATA-type
SMARTSM004014.2E-152084IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.5E-142460IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.48E-142560No hitNo description
PfamPF003204.6E-162660IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402651IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MDSSVEKGSG SLDPDERPAA GEPKACTECH TTKTPLWRGG PCGPMSLCNA CGIRYRKKRR  60
EALGLDSSKS NADQQQQQRK KKTKREKERE EEGEVTVQLR SVGFGKEVVL KQRRRMRRRR  120
RLGEEERAAI LLMALSSGVV YA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17784QRKKKTKR
27885RKKKTKRE
3111117QRRRMRR
4113118RRMRRR
5113120RRMRRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631979.11e-64PREDICTED: GATA transcription factor 16
TrEMBLA0A0D3FQY41e-64A0A0D3FQY4_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9ZFB61e-64A0A0D9ZFB6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GVZ01e-64A0A0E0GVZ0_ORYNI; Uncharacterized protein
TrEMBLA0A0E0P3H01e-64A0A0E0P3H0_ORYRU; Uncharacterized protein
TrEMBLA2XNM31e-64A2XNM3_ORYSI; Putative uncharacterized protein
TrEMBLQ850Z51e-64Q850Z5_ORYSJ; Expressed protein
STRINGBGIOSGA013867-PA4e-64(Oryza sativa Indica Group)
STRINGBGIOSGA013869-PA4e-64(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24183892