PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06953.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 470aa    MW: 51766.1 Da    PI: 10.5775
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06953.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601261.8e-39375469195
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++pe er da+ slvyeA+ r+rdPvyG++g i+
  Zmw_sc06953.1.g00020.1.am.mk 375 PCAACKLLRRRCAQECPFAPYFSPHEPQKFAAVHKVFGASNVSKMLLEVPEAERGDAVGSLVYEANLRLRDPVYGCMGAIS 455
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaela 95 
                                   +lqqql+ l+ael+
  Zmw_sc06953.1.g00020.1.am.mk 456 DLQQQLNALEAELE 469
                                   ***********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF050971.5E-5108146IPR007789Protein of unknown function DUF688
PROSITE profilePS5089124.661374470IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-40375469IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MPLDNRLDHA YPRLLPRCNP VLPPSSRKRY YYSTGTHERL DRSSVPEMPP GVAVGDQQAA  60
APPPSPRRGI LLPQSPLRIK QDGKFYERLL TRESASAGNL SFRYYWAEPG SVPFVWETQP  120
GTPKDVAGMA AGALPAITPP PSYLLRHGTG SKLTAASHHE QSKKGKRKGC RLRRIRMGFV  180
TGIFRRLSLM KAWRRFVPPP INVSSSSSRW LFSSVATTER GKHDDHHENE RKTAMCGSFR  240
FRARPSPWLP RFRSAGSVDG GQSWTLKVIR RDSSVVVDDS HRTTKLDGQV MISREVQTAA  300
GAINCWATGR RATEDDAARG DGRRATAAER LDKIRKKIKG EPEASGITPS ASTVAAETPV  360
PRRLGLGGAL NTVTPCAACK LLRRRCAQEC PFAPYFSPHE PQKFAAVHKV FGASNVSKML  420
LEVPEAERGD AVGSLVYEAN LRLRDPVYGC MGAISDLQQQ LNALEAELEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-3737547011106LOB family transfactor Ramosa2.1
5ly0_B2e-3737547011106LOB family transfactor Ramosa2.1