PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06925.1.g00010.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 280aa    MW: 30960.6 Da    PI: 9.5603
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPt+eel+ +yL++kveg+++++ + i+++d+y+++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t+sgy 142 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-DLIADLDLYRFDPWELPAMAVMGGKEWFFYVPRDRKYRNGDRPNRVTASGY 221
                                   79***************************.99***************7767789*************************** PP

                           NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg d+ +  ++++ +glkktLvfy+g+apkg++++W+m+eyrl 222 WKATGADRMIRGENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 267
                                   ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-55141272IPR003441NAC domain
PROSITE profilePS5100551.717141280IPR003441NAC domain
PfamPF023656.4E-25143267IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-5414327119146NO APICAL MERISTEM PROTEIN
1ut4_B4e-5414327119146NO APICAL MERISTEM PROTEIN
1ut7_A4e-5414327119146NO APICAL MERISTEM PROTEIN
1ut7_B4e-5414327119146NO APICAL MERISTEM PROTEIN
3swm_A5e-5414327122149NAC domain-containing protein 19
3swm_B5e-5414327122149NAC domain-containing protein 19
3swm_C5e-5414327122149NAC domain-containing protein 19
3swm_D5e-5414327122149NAC domain-containing protein 19
3swp_A5e-5414327122149NAC domain-containing protein 19
3swp_B5e-5414327122149NAC domain-containing protein 19
3swp_C5e-5414327122149NAC domain-containing protein 19
3swp_D5e-5414327122149NAC domain-containing protein 19
4dul_A4e-5414327119146NAC domain-containing protein 19
4dul_B4e-5414327119146NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962060.11e-106NAC domain-containing protein 35
TrEMBLK3Z6L91e-105K3Z6L9_SETIT; Uncharacterized protein
STRINGPavir.J00477.1.p1e-108(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number