PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06693.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 172aa    MW: 19024.5 Da    PI: 9.2917
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06693.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.35.2e-163696363
                                    XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                                    elkr rr+++NRe+ArrsR+RK++ ++ L+  v++L+a+ ++L+  l+   +++a+ ++++
  Zmw_sc06693.1.g00020.1.sm.mkhc 36 ELKRKRRMESNRESARRSRLRKQQHLDDLTSQVDQLKAKKQQLITALNVTANNYAAAEAQN 96
                                    79********************************************999999998877766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-153498IPR004827Basic-leucine zipper domain
PfamPF001709.2E-133691IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3813678IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-113883No hitNo description
SuperFamilySSF579591.69E-113889No hitNo description
CDDcd147021.02E-153990No hitNo description
PROSITE patternPS0003604156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MSLSGGTFSS GTSSGSSLGT LSCGSEGDME LQARMELKRK RRMESNRESA RRSRLRKQQH  60
LDDLTSQVDQ LKAKKQQLIT ALNVTANNYA AAEAQNSVLR ARMMELQNRL CTLREIIYCM  120
NLNQLTNAAT VANTPSTVVS ATANYDAFGA STWNSGMQMV QQPIDQLLYQ CF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15056RRSRLRK
25057RRSRLRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822603.11e-93bZIP transcription factor 44-like isoform X1
TrEMBLA0A2S3I2092e-92A0A2S3I209_9POAL; Uncharacterized protein
STRINGSb07g015450.12e-82(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37403276