PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06586.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 424aa    MW: 46820.6 Da    PI: 9.7448
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06586.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.31.9e-501532801128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrF P+deelv++yL kkv++++     ++ evd++  ePw+Lp ++k + +ewyfFs rd+kyatg+r+nratk+g
  Zmw_sc06586.1.g00010.1.am.mk 153 LPPGFRFYPSDEELVCHYLYKKVANERAAQ-GTLVEVDLHAREPWELPDAAKLTASEWYFFSFRDRKYATGSRTNRATKTG 232
                                   79*************************776.78***************87788899************************* PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkd+ev s  +++++g++ktLvfy+grap+g+k+ Wvmhe+rl
  Zmw_sc06586.1.g00010.1.am.mk 233 YWKATGKDREVRSPaTRAVIGMRKTLVFYRGRAPNGVKSGWVMHEFRL 280
                                   *************977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-59150298IPR003441NAC domain
PROSITE profilePS5100558.144153299IPR003441NAC domain
PfamPF023659.2E-28154280IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MPSLRRMDNL RGCASSNVRP IRRTGRARAS SSCATSIHGN TSSVDRSISA LRNLPPKPAG  60
SIQLMGGRPG WQRDARFRDK TWGSSALLSQ RSLFQPSQLA LHRYLSPAAA SLVPLQKQST  120
AGNQPHSRYT KWPLVAPLDR DGGMGLREIE STLPPGFRFY PSDEELVCHY LYKKVANERA  180
AQGTLVEVDL HAREPWELPD AAKLTASEWY FFSFRDRKYA TGSRTNRATK TGYWKATGKD  240
REVRSPATRA VIGMRKTLVF YRGRAPNGVK SGWVMHEFRL DSPHTPPKED WVLCRVLEKR  300
KDGEQDNGGA GSSSSPPFAG SSQAAVVPPD QPVMVDADAY CADHQTARSP VGFAPPQDQG  360
PLLDATIWQY SSVLDHQYSQ EVSSSLTMMT GLGSRFDGFF YDTGFEDVMA ANVEGVGFPQ  420
GWMG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-481443051174Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824637.11e-142protein CUP-SHAPED COTYLEDON 1-like
TrEMBLA0A2T7CXR41e-141A0A2T7CXR4_9POAL; Uncharacterized protein
STRINGPavir.Gb00655.1.p1e-140(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166