PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06495.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 781aa    MW: 83881.1 Da    PI: 5.9824
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06495.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS53.45.2e-17282351270
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsets 70 
                                   v +L++cA+ +++ d+++a+ +Larl e+asp+g +pm+R+aayf+eALa r++r++++l++  pp+e +
  Zmw_sc06495.1.g00040.1.sm.mk 282 VGALTACADSLATCDQHAADYYLARLGEMASPAGpTPMHRVAAYFAEALAIRVVRMWPHLFDVTPPRELT 351
                                   678***********************************************************99999876 PP

2GRAS292.89.1e-9035562918297
                          GRAS  18 elaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPilkfshl 96 
                                   ++a+ +Larl e+asp+g +pm+R+aayf+eALa r++r++++l++  pp+e ++    ++ ++al++++ v+Pi++f h+
  Zmw_sc06495.1.g00040.1.sm.mk 355 HAADYYLARLGEMASPAGpTPMHRVAAYFAEALAIRVVRMWPHLFDVTPPRELTDGAvDDDDAMALRILNAVTPIPRFLHF 435
                                   6899************************************************998886788999***************** PP

                          GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                                   t N+ +l+a+eg++rvH+iDfdi+qGlQWp Llq+La+R+++p+++RiTgvg+    s++el+etg rL+++A++lg+ fe
  Zmw_sc06495.1.g00040.1.sm.mk 436 TLNERLLRAFEGHDRVHVIDFDIKQGLQWPGLLQSLAARASPPAHVRITGVGE----SRQELQETGARLEHVAASLGLAFE 512
                                   *****************************************************....9*********************** PP

                          GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                                   f++ v++rled++l++L+vk+gE++aVn+vl +hrll+++   +    ++L lv+s+ + ++ + e+e  +ns+++ +rf+
  Zmw_sc06495.1.g00040.1.sm.mk 513 FHA-VVDRLEDVRLWMLHVKRGECVAVNCVLTVHRLLRDESGAS--LADFLGLVRSTGAAILLLGEHEDALNSGRWEARFA 590
                                   ***.7********************************6554444..589******************************** PP

                          GRAS 259 ealeyysalfdsl.eaklpreseerikvErellgreivnv 297
                                   +al+yy+a fd++ +a+l+ +s +r+k E++ ++rei+n+
  Zmw_sc06495.1.g00040.1.sm.mk 591 RALRYYAAAFDAVdAAGLAYASPARTKAEEM-FAREIRNA 629
                                   *************9999**************.*****995 PP

3GRAS104.61.4e-32630751255374
                          GRAS 255 erflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                                   +rf++al+yy+a fd++ +a+l+ +s +r+k E++ ++rei+n+va eg++r+erh t++ Wr+r+e++GFk++ +++++a
  Zmw_sc06495.1.g00040.1.sm.mk 630 ARFARALRYYAAAFDAVdAAGLAYASPARTKAEEM-FAREIRNAVAFEGTDRFERHDTFAGWRRRMEDCGFKNAGIGDREA 709
                                   79***************9999**************.********************************************* PP

                          GRAS 335 kqaklllrkvksdgyrveee..sgslvlgWkdrpLvsvSaWr 374
                                   +q +l+ r+++   yrv+ +   ++l+l W ++++++vSaW+
  Zmw_sc06495.1.g00040.1.sm.mk 710 MQGRLISRMFAPGNYRVQAQgdGEALTLQWLNQAMYTVSAWT 751
                                   ***********555***9654256677**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.219255729IPR005202Transcription factor GRAS
PfamPF035141.8E-14282351IPR005202Transcription factor GRAS
PfamPF035143.1E-87355629IPR005202Transcription factor GRAS
PfamPF035145.0E-30630751IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MEVSACRSLG LAVVVAAVRA LRHSMLSLVQ EEEEEEEEGD EEEGNKFLLG TSHPAVSPIS  60
GMLAGCSFSS SRHQMSTTPR FDILQCGFSK RSNRGGDGAA APRVAAADPR AGGGNCSFRA  120
HPAPVTQAVS WGAKQEPSGN VAGGFWERSR AIKRAHEEDA VEEYGGPTVR AKRTRMGGDG  180
DEVWFHQSIA GTVQQAAPGE GEESEEEKVF LVPSAATFPH GMAAAGPSLA AAKQEFSNSP  240
SPASSGGTDG GGTSAVPPPP QVHARNGVPA HGEAGRETME LVGALTACAD SLATCDQHAA  300
DYYLARLGEM ASPAGPTPMH RVAAYFAEAL AIRVVRMWPH LFDVTPPREL TDGAHAADYY  360
LARLGEMASP AGPTPMHRVA AYFAEALAIR VVRMWPHLFD VTPPRELTDG AVDDDDAMAL  420
RILNAVTPIP RFLHFTLNER LLRAFEGHDR VHVIDFDIKQ GLQWPGLLQS LAARASPPAH  480
VRITGVGESR QELQETGARL EHVAASLGLA FEFHAVVDRL EDVRLWMLHV KRGECVAVNC  540
VLTVHRLLRD ESGASLADFL GLVRSTGAAI LLLGEHEDAL NSGRWEARFA RALRYYAAAF  600
DAVDAAGLAY ASPARTKAEE MFAREIRNAA RFARALRYYA AAFDAVDAAG LAYASPARTK  660
AEEMFAREIR NAVAFEGTDR FERHDTFAGW RRRMEDCGFK NAGIGDREAM QGRLISRMFA  720
PGNYRVQAQG DGEALTLQWL NQAMYTVSAW TPASDGDAGG STVSASLSVS VSTTASHSQQ  780
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3436175026374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964401.10.0PREDICTED: scarecrow-like protein 28
TrEMBLK3Y2010.0K3Y201_SETIT; Uncharacterized protein
STRINGSi008220m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455