PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06470.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 622aa    MW: 69842 Da    PI: 11.8011
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06470.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.79.5e-493775251128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk........................kvkaeeke 57 
                                   lppGfrFhPtdeelv++yL+++++g ++ + ++ike+d+yk++Pw+Lp+                        ++  +eke
  Zmw_sc06470.1.g00030.1.am.mk 377 LPPGFRFHPTDEELVMHYLCRRCTGMPIAV-SIIKEIDLYKFDPWQLPStsfvlaaleflgslpelyenfsdrMALYGEKE 456
                                   79**************************99.89***************5589*********9999988877753333899* PP

                           NAM  58 wyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   wyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v +   + v +kk Lvfy+g+apkgekt+W+mheyrl
  Zmw_sc06470.1.g00030.1.am.mk 457 WYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGT--PKPVAIKKALVFYTGKAPKGEKTNWIMHEYRL 525
                                   ***********************************98..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-50374528IPR003441NAC domain
PROSITE profilePS5100551.897377545IPR003441NAC domain
PfamPF023651.8E-25378525IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MSTLLTELPL ASYEHSLLTG PRTARTQPNR SRSLGLGASR SIHATSNDSV SGPTTRAQCR  60
RLYRIRENSR VRDTGDRRAR ETAGAPSFSS PAVHAFGLYL PRRAVQAATW PRPSVRSRAQ  120
SRCHLDWRTS SVRLVLGLSW SREAYLQAFV RTFHGFSSSP VVFAVRSTPA NSFHRLLLHI  180
LLTQCRLIII RHLALARSGQ VILIHQPHAA PAHLALIART HPYFRGRRYT AGRTHVSRRH  240
RNGDAARRPC GPLRGRFPKA VRPTPAARRG PSLSLLCYRR AAAARARPSK KPDVSSDRIG  300
AFAWRRRGST GQSAAPRVRY RGGRAARATR VAVAKLYKCP APHQPPSHRA RESKDSEIRK  360
GGASTMSYGG GGQDLHLPPG FRFHPTDEEL VMHYLCRRCT GMPIAVSIIK EIDLYKFDPW  420
QLPSTSFVLA ALEFLGSLPE LYENFSDRMA LYGEKEWYFF SPRDRKYPNG SRPNRAAGSG  480
YWKATGADKP VGTPKPVAIK KALVFYTGKA PKGEKTNWIM HEYRLADVDR SARKKNSLRA  540
RVALSFGPLK NYRHGPCYRP EQGGLHSPND SDGCRRHDPK CESTRCHSPW PPAANHCRAS  600
PMRRRRPRWL VLSWSRGVLV QD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-5837553018150NAC domain-containing protein 19
3swm_B2e-5837553018150NAC domain-containing protein 19
3swm_C2e-5837553018150NAC domain-containing protein 19
3swm_D2e-5837553018150NAC domain-containing protein 19
3swp_A2e-5837553018150NAC domain-containing protein 19
3swp_B2e-5837553018150NAC domain-containing protein 19
3swp_C2e-5837553018150NAC domain-containing protein 19
3swp_D2e-5837553018150NAC domain-containing protein 19