PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06135.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 843aa    MW: 91055.5 Da    PI: 10.5812
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06135.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.65.8e-22189235248
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                                   C v+gC+adls++++yhrrhkvCe+hsk+pvv+v+g+e rfCqqCsr
  Zmw_sc06135.1.g00050.1.am.mk 189 CAVDGCKADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSR 235
                                   **********************************************9 PP

2SBP491.6e-152813134678
                                   TSSEEETTT--SS--S-STTTT-------S--- CS
                           SBP  46 CsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                    s fh+l efDe+krsCr+rL++hn+rrrk+q+
  Zmw_sc06135.1.g00050.1.am.mk 281 GSTFHQLAEFDETKRSCRKRLDGHNRRRRKPQP 313
                                   699***************************987 PP

3SRF-TF73.32e-23790839251
                                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   rie+   rqv fskRr+g++KKA+EL  LCda+va+i+fs+ g+lye++s
  Zmw_sc06135.1.g00050.1.am.mk 790 RIEDRVSRQVRFSKRRKGLFKKAFELAELCDAQVALIVFSPAGRLYEFAS 839
                                   8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.8E-27182232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114122.187186311IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-20187235IPR004333Transcription factor, SBP-box
PfamPF031101.6E-16189235IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.8E-27281298IPR004333Transcription factor, SBP-box
PfamPF031102.9E-8282310IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-12282316IPR004333Transcription factor, SBP-box
SMARTSM004322.0E-30781840IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.287781841IPR002100Transcription factor, MADS-box
CDDcd002655.34E-31783840No hitNo description
SuperFamilySSF554551.57E-23783841IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-24783803IPR002100Transcription factor, MADS-box
PfamPF003191.7E-23790837IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-24803818IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-24818839IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MEEGKFQLSL QVRTAPPVPG PSGLAFVAAK SLLVAIHAPA AAPSISPPPR RFITSAQLAR  60
PSLFDELELL HLRPRLPSIA VCSIWYCASG SRRRSSTVAA TVGRCSQENA RGMRVTGRGR  120
KPDASPPPNS DLTKGRTCRR RGRRARRSVA MDWDLKVPAS WDLAELEHDA GAAAAPAAGP  180
SGVHRCPSCA VDGCKADLSK CRDYHRRHKV CEAHSKTPVV VVAGREMRFC QQCSRDTAGD  240
QCSRGLCTVS PFDFSAQRSA ALLCTSDSIS LLMNSRLESG GSTFHQLAEF DETKRSCRKR  300
LDGHNRRRRK PQPDPMTSAN FITRQQGTRF SPFTTPRQDA TWPGIIKTEG SPYYSHQLPL  360
GTSNNRQQHF GVGSSSAYTK EGRRFPFLHQ EGEISFTTGM VLDAASSAVC QPLLKTVAAP  420
PETGGGGGSK MFSDGLTRVL DSDCALSLLS APANSSNIDV TRMVRPTEQV PLLAQQQPLL  480
SGLQFGTASW FPRPHQPVPA PATGAVATTT VAPTGMETEH HHQQMNAVLG GGAGDAGEMN  540
YNGMFHVAGE GTFSWQDVIQ RRAAASLRTS CICMRGEART GRARARAPAT HSSARMSSTE  600
CLGAPATHSL QSKNEACGPR RGPASQALDP RDGGEVGAVA NHGARSRGLH CALAPRAQRC  660
RGTWLLTALV GLLAFWGGGA HPLSAKAEPS SPLLLLPSTT FVGIPRLQSR FAPTPFMPCR  720
PARPSTRAQQ ARAHCKVAAI CMTKDMDAEE ARNPELRQRE EEARAGGEGD GRNEMKKAAK  780
KKRGRVEMRR IEDRVSRQVR FSKRRKGLFK KAFELAELCD AQVALIVFSP AGRLYEFASS  840
NSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A8e-16189235652squamosa promoter-binding protein-like 12
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1293310KRSCRKRLDGHNRRRRKP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795