PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06057.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 145aa    MW: 16248.4 Da    PI: 10.8583
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06057.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1361.6e-1162124163
                                   XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke +   ke+ +lk  +
  Zmw_sc06057.1.g00050.1.sm.mk  62 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNETMKKEKDLVMKEYLSLKETN 124
                                   89*********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-1262126IPR004827Basic-leucine zipper domain
PfamPF001702.6E-1062124IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.10564127IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-666122No hitNo description
SuperFamilySSF579599.14E-866122No hitNo description
CDDcd147026.05E-967117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MTDDEEMAST RLSLELGKVG IHSSSCSGSS SAGFPARHPA PAPAPGHGAP SGRPRHMLTE  60
AEKEAKRLRR VLANRESARQ TILRRQAIRD ELARKVADLS SQNETMKKEK DLVMKEYLSL  120
KETNRQLRAQ QAQHHHHHRL SLSLF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025809461.15e-62light-inducible protein CPRF2-like
TrEMBLA0A2S3H5Z71e-60A0A2S3H5Z7_9POAL; Uncharacterized protein
TrEMBLA0A2T7E5991e-60A0A2T7E599_9POAL; Uncharacterized protein
STRINGPavir.Cb02058.1.p3e-61(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475