PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06036.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 328aa    MW: 35877 Da    PI: 7.109
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06036.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.4e-53261531128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++kv +  +     i+evd++++ePw+Lp++++ +e+ewyfFs rd+ky+tg r+nrat +g
  Zmw_sc06036.1.g00030.1.sm.mk  26 LPPGFRFHPTDEELVTFYLAAKVFNGACCG-VDIAEVDLNRCEPWELPEAARMGEREWYFFSLRDRKYPTGLRTNRATGAG 105
                                   79************************9777.34***************9888999************************** PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkd+ev+++ +g l+g+kktLvfykgrap+gekt+Wv+heyrl
  Zmw_sc06036.1.g00030.1.sm.mk 106 YWKATGKDREVVNAaTGVLIGMKKTLVFYKGRAPRGEKTKWVLHEYRL 153
                                   ************9878889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-6224176IPR003441NAC domain
PROSITE profilePS5100558.64826176IPR003441NAC domain
PfamPF023651.5E-2727153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAMTDHQALA MGDALWDILG EQAGGLPPGF RFHPTDEELV TFYLAAKVFN GACCGVDIAE  60
VDLNRCEPWE LPEAARMGER EWYFFSLRDR KYPTGLRTNR ATGAGYWKAT GKDREVVNAA  120
TGVLIGMKKT LVFYKGRAPR GEKTKWVLHE YRLDGDFAAG RRSCKEEWVI CRIFHKAVDP  180
YSKMVMVKSP YFDHTMDPAT FCFLQQEPPH AALLLPNPSS CSGLAYALPF HHGLDNHHQG  240
KTSHSNGLPP ACSLEPTGRG ADMCGSATVP MLPPFPSFAS LVAGKAAPHQ QVGVNGGAPE  300
PPPPTWLDGY LPSGFLYEMS PPAAPRGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-482617617165NO APICAL MERISTEM PROTEIN
1ut4_B1e-482617617165NO APICAL MERISTEM PROTEIN
1ut7_A1e-482617617165NO APICAL MERISTEM PROTEIN
1ut7_B1e-482617617165NO APICAL MERISTEM PROTEIN
3swm_A1e-482617620168NAC domain-containing protein 19
3swm_B1e-482617620168NAC domain-containing protein 19
3swm_C1e-482617620168NAC domain-containing protein 19
3swm_D1e-482617620168NAC domain-containing protein 19
3swp_A1e-482617620168NAC domain-containing protein 19
3swp_B1e-482617620168NAC domain-containing protein 19
3swp_C1e-482617620168NAC domain-containing protein 19
3swp_D1e-482617620168NAC domain-containing protein 19
4dul_A1e-482617617165NAC domain-containing protein 19
4dul_B1e-482617617165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974840.11e-144NAC domain-containing protein 92
SwissprotQ9S8512e-88NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLK3YML71e-143K3YML7_SETIT; Uncharacterized protein
STRINGPavir.Fb01938.1.p1e-145(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112373341
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]