PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05932.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 220aa    MW: 23267.7 Da    PI: 8.4996
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05932.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.56.5e-22174220147
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTS CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCs 47 
                                   +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCs
  Zmw_sc05932.1.g00010.1.am.mk 174 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVTAGGKQQRFCQQCS 220
                                   6*********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-24167220IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.931172220IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-21172220IPR004333Transcription factor, SBP-box
PfamPF031101.1E-16175220IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MMSGRMNAVT SADGDDFPFA PSMQPPPPPP YVGFDPSVPG GGMGPQRAGG MPHHLYDDLD  60
LAAAAAMQFQ EAPHHHQLLT LPSSLAAPMA PPPPVPMSLQ MPMPGLHGDV YPALGMVKRE  120
GGGGAEGGRI GLNLGRRTYF SPGDMLAVDR LLMRSRLGGV FGLGFGGAHH QPPRCQAEGC  180
KADLSGAKHY HRRHKVCEYH AKASVVTAGG KQQRFCQQCS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A5e-17175220651squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965676.12e-82squamosa promoter-binding-like protein 10
SwissprotA2YFT97e-69SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE87e-69SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLA0A0A9G6E52e-93A0A0A9G6E5_ARUDO; Sbp3
STRINGSi006559m9e-82(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593