PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05872.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 412aa    MW: 43941.1 Da    PI: 8.3515
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05872.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.12.7e-19332366135
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                   Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Zmw_sc05872.1.g00020.1.am.mk 332 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 366
                                   *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.057326362IPR000679Zinc finger, GATA-type
SMARTSM004016.2E-18326380IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.23E-14329389No hitNo description
Gene3DG3DSA:3.30.50.101.9E-15330364IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.87E-15331388No hitNo description
PROSITE patternPS003440332357IPR000679Zinc finger, GATA-type
PfamPF003202.9E-17332366IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MTHQPISSSP PFPLLPSHFL HAPLAFPFHP LIFFFSLRLL LSAAAPAMAL FVAQHHGSLL  60
EREGRMDALR SSLRPCEAAE EVPTAAAWGA GDRGVGLFGE GFAVEDLLDL EELCEVEKDG  120
EAAPSPAVDE DKSSDSHGSS SVVSYELMPP PPPVIDLPAH DAEELEWVSR IMDDSLAELP  180
PAPHLPAASF ALRRQPEPAV PRMVPVATPT ICALSTEALV PVKAKRSKRS RGSVWSLSGA  240
APLSDSTSSS STSATSSCSS SSVSFPQLLL LDSSPFAASH LLEQAPRSKK LKHGKHGKSK  300
PKKRGRKPKH QPAAQFLGSD ASAQTPPGDR RCSHCGVQKT PQWRAGPEGA KTLCNACGVR  360
YKSGRLLPEY RPACSPTFVS GVHSNSHRKV LEMRRKEGLL VPAAIAPAVA SF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953279.11e-129PREDICTED: GATA transcription factor 5-like
TrEMBLA0A0A9LJV31e-131A0A0A9LJV3_ARUDO; Uncharacterized protein
STRINGSi017219m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108