PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05827.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 246aa    MW: 27960 Da    PI: 10.3913
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05827.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF831.8e-26959151
                                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                    +ri+n +nrqvtfskRr g++KKA EL +LCda+v +i+fs +g+lye+ss
  Zmw_sc05827.1.g00040.1.am.mkhc  9 ERIDNRINRQVTFSKRRSGLMKKARELGILCDADVGLIVFSCSGRLYEFSS 59
                                    69***********************************************96 PP

2K-box75.21.8e-251141961597
                           K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                                       +q+e++ L+++ +nLq ++RhllGe+L+ L++++Lq L++q+e sl++iR+kK++ll ++i +l +k  +lq+en +
  Zmw_sc05827.1.g00040.1.am.mkhc 114 DFWQREVTTLRQQAQNLQLNNRHLLGEELSGLTVRDLQFLQNQVEMSLQSIRKKKEQLLADEIMQLNQKGLALQKENIE 192
                                     68***************************************************************************** PP

                           K-box  94 Lrkk 97 
                                     L+k+
  Zmw_sc05827.1.g00040.1.am.mkhc 193 LKKE 196
                                     *987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.796161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-31276IPR002100Transcription factor, MADS-box
CDDcd002659.21E-41271No hitNo description
PRINTSPR004043.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003199.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.629113203IPR002487Transcription factor, K-box
PfamPF014862.4E-24114196IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRGKIAIER IDNRINRQVT FSKRRSGLMK KARELGILCD ADVGLIVFSC SGRLYEFSST  60
SMKSIIERYQ EAREENNSRL LNPVAEAKLR KLGDPSRPKE AWWRAVLLSA GYSDFWQREV  120
TTLRQQAQNL QLNNRHLLGE ELSGLTVRDL QFLQNQVEMS LQSIRKKKEQ LLADEIMQLN  180
QKGLALQKEN IELKKEASIA RRHKIELQKK LSAGKSTSSD GEEASGGSSD KAQDAFPMNH  240
PTIKSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-22287186Myocyte-specific enhancer factor 2A
3kov_B2e-22287186Myocyte-specific enhancer factor 2A
3kov_I2e-22287186Myocyte-specific enhancer factor 2A
3kov_J2e-22287186Myocyte-specific enhancer factor 2A
3p57_A2e-22287186Myocyte-specific enhancer factor 2A
3p57_B2e-22287186Myocyte-specific enhancer factor 2A
3p57_C2e-22287186Myocyte-specific enhancer factor 2A
3p57_D2e-22287186Myocyte-specific enhancer factor 2A
3p57_I2e-22287186Myocyte-specific enhancer factor 2A
3p57_J2e-22287186Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967658.11e-100PREDICTED: MADS-box transcription factor 25-like
SwissprotQ84NC52e-98MAD25_ORYSJ; MADS-box transcription factor 25
TrEMBLJ3LWM61e-95J3LWM6_ORYBR; Uncharacterized protein
TrEMBLQ01ME44e-96Q01ME4_ORYSA;
STRINGLOC_Os04g23910.16e-96(Oryza sativa Japonica Group)
STRINGOB04G15510.13e-95(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130