PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05817.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 551aa    MW: 58615 Da    PI: 7.6303
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05817.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.61.4e-17415449135
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                   C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Zmw_sc05817.1.g00010.1.am.mk 415 CLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRL 449
                                   99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.453409445IPR000679Zinc finger, GATA-type
SMARTSM004011.3E-18409459IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.3E-15410446IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.33E-15411472No hitNo description
CDDcd002022.91E-13414461No hitNo description
PfamPF003202.2E-15415449IPR000679Zinc finger, GATA-type
PROSITE patternPS003440415440IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MRLPTLPPRF DAAWRERPSW ARRAARAPGQ LAITWRVGFI IVLFASLYKL GREEHGPAGP  60
YLTQPTGRPL LFYRSGNPVA ALASSDGRRA ISGGSPTWWL RGRTRGPRDV RIFQGGLPAE  120
STWLDPRSRL IAPARKDESF ISADCAPASS SGLLHSALQR LRRVTAECRN GAVRAKKDAD  180
LFLVDDLLDL PCDDDEEEEE EEVVVEGEDT KAGVVSAAAH GDGEEGAAGN ASNESSTVTA  240
LDSCSNSLSD LADGGFSGGL CEPYDQLAEL EWLSNYMGED NFPTEDLRKL ELITGVPQAG  300
TAATKASTST PAPGPAQPCG GVLPPEAAVP AKARSKRSRI APFSWSSPLV VPPPPPASPP  360
SPASAAISPS ESGTGDTPAF SAKKPAKASK KKDSPTPPPA PTATAAAPAG EGRRCLHCET  420
DKTPQWRTGP MGPKTLCNAC GVRYKSGRLV PEYRPAASPT FVVSKHSNSH RKVLELRRQK  480
EVHLGGQAMP HPHPHHQHQS HLAHVGTGVG GGGLIHMPSP LLFDGPSAPL LTEDFLLHNS  540
VLPDFHHHQL I
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656467.11e-122PREDICTED: GATA transcription factor 12-like
TrEMBLA0A0A9PS031e-134A0A0A9PS03_ARUDO; Uncharacterized protein
STRINGGRMZM2G135381_P011e-121(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178