PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05804.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 359aa    MW: 39274.2 Da    PI: 9.8918
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05804.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM805.1e-25118554128
                           NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   e + w+fF++r++ +a+g r++r+t +gyWka g+  +v++++++++g++kt+vfy+grap+g+kt+W m+eyr+
  Zmw_sc05804.1.g00010.1.am.mk  11 EGEPWFFFCPRQEGEARGGRPSRVTPTGYWKAAGTPAAVYAADRRAIGVRKTMVFYRGRAPSGTKTTWKMNEYRA 85 
                                   5578*********************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.7331126IPR003441NAC domain
SuperFamilySSF1019414.32E-2610124IPR003441NAC domain
PfamPF023654.3E-131384IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
IHERLCGGAG EGEPWFFFCP RQEGEARGGR PSRVTPTGYW KAAGTPAAVY AADRRAIGVR  60
KTMVFYRGRA PSGTKTTWKM NEYRALQYDA GGTAEYGSSS SAHAASPLSL PSQLRSEFSL  120
CRLYTRSGVL RQFDRRPLAG AASCPGEGPA EPSMATAASL DDDDGSGEGT LNVPGILDRE  180
ERTGAVDHVR FTCRAQALDH HFLPGRVPSR EAHSCRQCTS RESERGRPLG AALDDRAIQL  240
LRCSDVQSGT RLPARTAHSQ VSSLASLSSP IFHGLVEWIW IPGRMEWQVR FRDSVLLSAH  300
FCRRGALPLS LCTFPEVDSL GNQQRGTTAT TRVSLRLRFP EGAAQRTGNK SRLKLNMIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-17108769144NO APICAL MERISTEM PROTEIN
1ut4_B1e-17108769144NO APICAL MERISTEM PROTEIN
1ut7_A1e-17108769144NO APICAL MERISTEM PROTEIN
1ut7_B1e-17108769144NO APICAL MERISTEM PROTEIN
3swm_A1e-17108772147NAC domain-containing protein 19
3swm_B1e-17108772147NAC domain-containing protein 19
3swm_C1e-17108772147NAC domain-containing protein 19
3swm_D1e-17108772147NAC domain-containing protein 19
3swp_A1e-17108772147NAC domain-containing protein 19
3swp_B1e-17108772147NAC domain-containing protein 19
3swp_C1e-17108772147NAC domain-containing protein 19
3swp_D1e-17108772147NAC domain-containing protein 19
4dul_A1e-17108769144NAC domain-containing protein 19
4dul_B1e-17108769144NAC domain-containing protein 19