PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05726.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 1620aa    MW: 177320 Da    PI: 9.2805
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05726.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP71.21.8e-2212781326149
                                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                           SBP    1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49  
                                    +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCsr 
  Zmw_sc05726.1.g00010.1.am.mk 1278 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVTAGGKQQRFCQQCSRS 1326
                                    6**********************************************96 PP

2SBP60.34.8e-1913381379849
                                    ----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                           SBP    8 eadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49  
                                    +adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCsr 
  Zmw_sc05726.1.g00010.1.am.mk 1338 SADLSGAKHYHRRHKVCEYHAKASVVTAGGKQQRFCQQCSRV 1379
                                    58**************************************96 PP

3SBP45.61.9e-14143114624677
                                    TSSEEETTT--SS--S-STTTT-------S-- CS
                           SBP   46 CsrfhelsefDeekrsCrrrLakhnerrrkkq 77  
                                       fh l+efDe+krsCr+rLa+hn+rrrk++
  Zmw_sc05726.1.g00010.1.am.mk 1431 FPEFHVLTEFDEAKRSCRKRLAEHNRRRRKPA 1462
                                    468***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS513755.93112IPR002885Pentatricopeptide repeat
PfamPF130414.2E-91262IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.1371348IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007562.3E-41549IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.5E-948198IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS5137511.5424983IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.3E-55283IPR002885Pentatricopeptide repeat
PfamPF130415.9E-1483124IPR002885Pentatricopeptide repeat
PROSITE profilePS5137513.32984118IPR002885Pentatricopeptide repeat
SuperFamilySSF484522.65E-586181IPR011990Tetratricopeptide-like helical domain
TIGRFAMsTIGR007561.4E-1086120IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.224119153IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007569.0E-4121155IPR002885Pentatricopeptide repeat
PfamPF130419.0E-15153200IPR002885Pentatricopeptide repeat
PROSITE profilePS5137514.02154188IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.1E-10156190IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.391189223IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.8E-5192224IPR002885Pentatricopeptide repeat
PROSITE profilePS513759.81224258IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.4E-4226258IPR002885Pentatricopeptide repeat
PfamPF171772.2E-10229347IPR033443Pentacotripeptide-repeat region of PROPR
Gene3DG3DSA:1.25.40.101.5E-9257275IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS5137512.003259293IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007562.9E-7262293IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.108.2E-7276529IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS5137511.498294328IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007564.4E-6297330IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.007329363IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.818364398IPR002885Pentatricopeptide repeat
PfamPF138122.5E-13388446IPR002885Pentatricopeptide repeat
PROSITE profilePS5137512.814399433IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007562.8E-8401434IPR002885Pentatricopeptide repeat
PROSITE profilePS513759.317434464IPR002885Pentatricopeptide repeat
PfamPF128545.6E-13467497IPR002885Pentatricopeptide repeat
PROSITE profilePS5137513.647470504IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007568.1E-7472504IPR002885Pentatricopeptide repeat
PROSITE profilePS513755.974505540IPR002885Pentatricopeptide repeat
PfamPF015350.066507530IPR002885Pentatricopeptide repeat
Gene3DG3DSA:4.10.1100.101.0E-2412711328IPR004333Transcription factor, SBP-box
PROSITE profilePS5114121.87112761353IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-2212771328IPR004333Transcription factor, SBP-box
PfamPF031101.9E-1712791328IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.8E-2013391375IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-1713391395IPR004333Transcription factor, SBP-box
PfamPF031106.4E-1413391379IPR004333Transcription factor, SBP-box
PROSITE profilePS5114112.81913731461IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.8E-2014191448IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.65E-1114271464IPR004333Transcription factor, SBP-box
PfamPF031102.5E-714331460IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1620 aa     Download sequence    Send to blast
LFDEMRRHGV APTLVTYNVV LDVYGRMGRS WPRIVALLEE MRAAGFEPDD FTASTVIAAC  60
CRDGLVDEAV AFFEDLKARG HTPCVVTYNA LLQVFGKAGN YSEALRVLKE MEQNGCRPDA  120
VTYNELAGTY ARAGFYDEAA KCLDTMTTKG LLPNTFTYNT VMTAYGNIGK VDEALALFDR  180
MKKGGCVPNV NTYNLILGML GKKSKFTLML EMLGEMSRSG CTPNRVTWNT MLAVCGKRGM  240
EEYVTRVLDG MKSCGVELSR DTYNTLISAY GRCGSRTHAF KMYDEMTSAG LAPCLTTYNA  300
LLNVLSRQGD WSTAQSIISK MRTKGFKPNE QSYSLLLQCY AKGDHIAGIE AIEKEVYGGT  360
VFPSWVILRT LVIANFKCRR LEGIENAFEE VKARGYKPDL VIYNSMLSMY AKNGMYRKAT  420
EMFDSIKQSG LSPDLITYNS LMDMYAKCNE SWEAEKILNQ LKSSPQVKPD VVSYNTVING  480
FCKQGLIKEA QRILSEMIAD GMAPCVITYH TLVGGYASME MFSEARELFH AEYLLIPLAG  540
EVMHRAGGRV QQQHTTPRKE LECWSKSRSS SPRRAGSRTP CCTALRSQAD VTCRSAVFSS  600
KERRGNGLYY VLVRPYDCGM QDKESEYSCV VLHVVEGTSD RFCYESRSPA PAMPGAWASG  660
AAPALGTLDD WAAGPVPVCS AAGVPLLPAD QAGCPFPHAR AESTPTHFVL AHASRIDRQK  720
LQLAAAEPAR ALRTVPRPSE RAGSHARHSL ARVPVLRRRV ADHRFVHSIS VHVAGAYLRT  780
DERASESTIV VNTNTSSFTR LALLALLPLA TSAIDTGRPG RQGVVDRPAR GPPAGVRRSQ  840
VAAASKVARD PEACVRARAR PAARRHQPGR ISSASRRRRP RRDTLRATCL LAVSRGPYSR  900
HCTQGVETFA NRHPIIRSPD AGGAHCALVT APTATVRFLG ARRQAPIRSE PETNEEADRM  960
PTSCACRSCQ PPALSPLRSV LPAVMAPAPA GTQSDPAYPG CSAQREIAAL RTFRPGRYGS  1020
GRLRTPFHQL RHHSMAPPCR GNRQRCRSPA VFFRSFPSTS GYRDDRGSCR EIERAMHDLT  1080
SVHHHHTLAP LLLITGCRTI DRPAMMSGRM NAVTSADGDD FPFAPSMQPP PWRPYVGFDH  1140
GVAGGGMGAQ RAGGMPHHLY DDLDFAAAAA MQFQEAPHHH QLLTLPSSLA APMAPPPPVP  1200
MSLQMPMPGL HGDVYPALGM VKREGGGGAE GGRIGLNLGR RTYFSPGDML AVDRLLMRSR  1260
LGGVFGLGFG GAHHQPPRCQ AEGCKADLSG AKHYHRRHKV CEYHAKASVV TAGGKQQRFC  1320
QQCSRSDRAP SFLPFVLSAD LSGAKHYHRR HKVCEYHAKA SVVTAGGKQQ RFCQQCSRVG  1380
SRGDMLLVRV PCLSWVVAMA EGCGFLLLAC RAQESNLTCT STGASRWPCP FPEFHVLTEF  1440
DEAKRSCRKR LAEHNRRRRK PATTAVSSKD GGEPTAKKAN TGAITSSYAT DNKNLMSTPK  1500
PTVSSNTSSM ISCLDQGKQA RPTLTLGAAQ VDKDQQQQQQ QLSTMLQVQP SADHQEQHFL  1560
TSLQVHHHHQ NSSSNNNNIL SCSSVCSSAL PQAANGELSD QTNNNNNGNG NMHLFEMDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4oe1_A0.0153852700Chloroplast pentatricopeptide repeat protein 10
4oe1_B0.0153852700Chloroplast pentatricopeptide repeat protein 10
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1875882RRRRPRRD
214431460KRSCRKRLAEHNRRRRKP