PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05704.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GeBP
Protein Properties Length: 282aa    MW: 30932 Da    PI: 10.6392
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05704.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57384.21.8e-2674168297
                        DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfsk 82 
                                   +f r+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+Kf+ +++++++g +p+  +
  Zmw_sc05704.1.g00010.1.sm.mk  74 KFPRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKFRSMSARVAKGLDPARLA 153
                                   699******************.556878888************************************************** PP

                        DUF573  83 ehdqkifelskkiWg 97 
                                   +hd+++++l++++W+
  Zmw_sc05704.1.g00010.1.sm.mk 154 PHDRDVLHLCSRLWD 168
                                   **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.1E-2475168IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MASDDQQTLP VPVPVPVPPN PTATPTAPAD PTAPSGARKL PIKRRSPRPS SSSPPSSGSD  60
QQQGQEQEPQ PPFKFPRIWS ESDELRFLQG LLGCGAQGLV FPRDLNVFYD RFSESMPQPY  120
TRSQLSEKLR RLKNKFRSMS ARVAKGLDPA RLAPHDRDVL HLCSRLWDPA NAATSPFAAS  180
AGTGASGNRR RRANPHGTLH EHRMANAVLD VFEECLREAK ANGIFRGGNA KGSASESELT  240
KRWRAQRMDE LDVLNRRLRL LVEDTAAAGI INMATSVGIG IW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143574.12e-84uncharacterized protein LOC100276272
TrEMBLB6T7U52e-84B6T7U5_MAIZE; Putative uncharacterized protein
STRINGGRMZM2G041818_P013e-82(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243