PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05692.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 368aa    MW: 40541 Da    PI: 6.8805
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05692.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.2e-53261541129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknra 77 
                                     l+pGfrFhPtdeelv++yLk+kv g++l++ ++i+evd+yk+ePwdLp  +++++++++wyfFs+ d+k+a+  r+nra
  Zmw_sc05692.1.g00060.1.sm.mkhc  26 LAPGFRFHPTDEELVSYYLKRKVLGRPLKV-DAIAEVDLYKIEPWDLPgrSRLRSRDSQWYFFSRLDRKHANRARTNRA 103
                                     579***************************.99***************6448888999********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     t+ gyWk+tgkd+ev + + ++vg+kktLvf+ grapkg++t+Wvmheyrle
  Zmw_sc05692.1.g00060.1.sm.mkhc 104 TNGGYWKTTGKDREVRN-GPRVVGMKKTLVFHAGRAPKGQRTNWVMHEYRLE 154
                                     ****************9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6221171IPR003441NAC domain
PROSITE profilePS5100559.56726171IPR003441NAC domain
PfamPF023655.8E-2928153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MALPSSSSSS APPLPAPAGA AEATSLAPGF RFHPTDEELV SYYLKRKVLG RPLKVDAIAE  60
VDLYKIEPWD LPGRSRLRSR DSQWYFFSRL DRKHANRART NRATNGGYWK TTGKDREVRN  120
GPRVVGMKKT LVFHAGRAPK GQRTNWVMHE YRLEGDEIPQ DSFVVCRIFQ KAGPGPQNGA  180
QYGAPFVEEE WEEEEEDEDV GLLPVEVDAV AEPQPLGAME KGYLQMSDLT QGLGDQNGND  240
GKAKSGIVGQ KFIKILDSIS SPPAFAAESP SNLHKTIAPI SGARPNTFHV SAEVISIGSL  300
AVSSRPDKWA VQKDQGMELL LTSFEPESRM HCGCNTITAV LRGGFCMFFF SAIMLLVSYE  360
VGLYIYGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-47201719168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444576.11e-130NAC domain-containing protein 53
TrEMBLA0A1Z5RAV31e-128A0A1Z5RAV3_SORBI; Uncharacterized protein
STRINGSb07g023900.11e-129(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650