PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05456.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 817aa    MW: 90113.5 Da    PI: 10.735
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05456.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind80.42.8e-25199259262
                                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
                  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 
                                   Fl+k+y++++d+++++++sws+++nsfvv+d++ fa+ +Lp++Fkh+nf+SFvRQLn+Y  
  Zmw_sc05456.1.g00030.1.am.mk 199 FLTKTYDMVDDPTTDHVVSWSATNNSFVVWDPHAFATVMLPRHFKHNNFSSFVRQLNTYRH 259
                                   9********************999***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF467853.4E-24195267IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.102.8E-27195260IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004153.2E-32195267IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.5E-13199222IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.6E-21199265IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.5E-13237249IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.5E-13250262IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF005042.4E-9698807IPR022796Chlorophyll A-B binding protein
SuperFamilySSF1035111.05E-19699816IPR023329Chlorophyll a/b binding protein domain
Gene3DG3DSA:1.20.1620.107.9E-8715815No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MGLYLSFVHR RRRHLSPSAH LRPKPRPISP RAPPPATRPP SSFHLLSPSV RPPPSPPVPA  60
ARDRDPISLS SLAFRNLPFP KQEPLAFPKS RRLLLLSCPA PATTTHLRCS GRRKDPRLGR  120
RPWRWLGASS FLLARGFWVP VCRLLLFFRL YLQVEMERLK EEVSHGEGGL LGAAAGDGHG  180
SVAAPRPMEG LQDGGPPPFL TKTYDMVDDP TTDHVVSWSA TNNSFVVWDP HAFATVMLPR  240
HFKHNNFSSF VRQLNTYRHL LKNIRRRKPP AHNSPNQQSV SPYLEVGHFG YDAEIDRLKR  300
DKQLLMAEVV KLRQEQQNTK ANLKAMEDRL QGTEQKQQQM MAFLARVMRN PEFLKQLMSQ  360
NEMRKELQEA ISKKRRRRID QGPEDDDLGA TSSLEQGSPL LFDPSEPADF LIDGIPTDIG  420
NSVLDPEVLA QPQNIDLGTS EPQQNVPQGD LNEDFWGELL NEGFAEENDN HVIEDDMNLL  480
SEKMEKGRCS RSLSLRSPDT GSPHRLHGGR SVHVDGDVNT VHHLQGSREL LATTVHGGGL  540
TVSTPVAGDR HALDRRAFAG RPRWPGPSRP HTATTSRPET RAELAVNTVP STSRRTTCTR  600
LPALPRARAG LNHIYGRGSP ADVAPARPPP QWSRRHSHGR LTRNRSLSLS SPYKSARPLH  660
SKFPMATMMS SLTFGRSPVA GLAPRRRAVV VRAQSKDVKP STGLWDALAF SGPAPERTNG  720
RLAMVGFVSA LAVEASTRGD GLLAQAASGT SQAWFAYAVA ALSVASLAPL LQGESAEARS  780
HGLMNADAEL WNGRLAMVGI VALAVTEYLT GAPFINA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B3e-161972572787Heat shock factor protein 1
5d5v_B3e-161972572787Heat shock factor protein 1
5d5v_D3e-161972572787Heat shock factor protein 1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110117GRRKDPRL
2372377KKRRRR
3373378KRRRRI
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30837231