PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05287.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 512aa    MW: 53954.8 Da    PI: 10.5738
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05287.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-42263361199
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+k+l++l++ +reda++sl+yeA++r+rdPvyG+vgvi+
  Zmw_sc05287.1.g00020.1.am.mk 263 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKILNELHPCQREDAVNSLAYEADMRLRDPVYGCVGVIS 343
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallke 99 
                                    lq++l+q ++el +++ 
  Zmw_sc05287.1.g00020.1.am.mk 344 VLQHRLRQIQQELTRAHY 361
                                   *************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.842262363IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-42263359IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MPDQLPAKEA CVDKTCLRPT ERVLKPATGC FSCWSLTPAS RALLQRLRDR PSIQSPTGTI  60
TSQPRESRSL APPDPGWRIN HWSPAHGLWG GGDLLWSAVF AATYAARPTA RTPRAEKNAS  120
RRWPAGIPGG ASEERTTPLI DPGRARPGHH RGGCACRRSA LQARSTGLNS PGSRRSVPDV  180
IGRGSEAEQQ RGRKPRRRTL PHGKHTGVGS TEKGRKRGRS MGSSSASSVP VSTTGSVITG  240
TAASSPTVGS ISLGAAGTGT GSPCAACKFL RRKCQPDCVF APYFPPDNPQ KFVHVHRVFG  300
ASNVTKILNE LHPCQREDAV NSLAYEADMR LRDPVYGCVG VISVLQHRLR QIQQELTRAH  360
YELSKYQVAA EAAAAASATV GSNAGPAPMP DFIGNPVPNC TQNFINMGGH SMAATIGGAG  420
FMQHDQFATV QMLARSYDAE PTTTARVGLS VGGGGDGGYG FGYSSSLGGE HSGLGSISGP  480
FLSPAPPAGT SAPQPRSSGM FSHLRQVRST AL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-512593667114LOB family transfactor Ramosa2.1
5ly0_B4e-512593667114LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808846.11e-108LOB domain-containing protein 6-like
TrEMBLA0A2S3HCF21e-107A0A2S3HCF2_9POAL; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895