PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05230.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 354aa    MW: 38556.1 Da    PI: 8.3322
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05230.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.99.2e-41152228278
                                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                     CqvegC+ dls+ak+yhr+h+vCe+hskap+v+v+gle+rfCqqCs+fh+lsefD+ krsCrrrL++hn+rrrk+q+
  Zmw_sc05230.1.g00020.1.am.mkhc 152 CQVEGCKFDLSSAKNYHRKHRVCEAHSKAPKVIVNGLERRFCQQCSQFHALSEFDQIKRSCRRRLNDHNARRRKQQP 228
                                     **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.9E-33145213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.624149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.05E-38150231IPR004333Transcription factor, SBP-box
PfamPF031107.8E-31152225IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MDWSQRGSML WDWENLSPIG ANSNDNPTIS LQAEPKFACF EDTGHESVHS SCGTFSSNSE  60
MGYCSSKSSI ASIDSSPKPR DTVELNFALV KVLGKGTDHK TALGKVDDAR SSPSSVIAVS  120
SGEPVIGLKL VTPTTTSTKK AKVAQTAQNV YCQVEGCKFD LSSAKNYHRK HRVCEAHSKA  180
PKVIVNGLER RFCQQCSQFH ALSEFDQIKR SCRRRLNDHN ARRRKQQPDA ISFGASRLST  240
MFYGIEASVA AANLNGAPDL QRALSLLSNN SADASSDQPI SQLHPALVTI ASSYNPVVQG  300
SSGLWQDGTA LDHEARFQAF DPVSNRSPIA APHQLHLLKL PAYDSSPSRY DQMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-271522251184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826432.11e-116squamosa promoter-binding-like protein 3
RefseqXP_025826439.11e-116squamosa promoter-binding-like protein 3
RefseqXP_025826447.11e-116squamosa promoter-binding-like protein 3
SwissprotA2YGR53e-74SPL12_ORYSI; Squamosa promoter-binding-like protein 12
SwissprotQ5Z8183e-74SPL12_ORYSJ; Squamosa promoter-binding-like protein 12
TrEMBLA0A1E5VW921e-141A0A1E5VW92_9POAL; Squamosa promoter-binding-like protein 12
STRINGPavir.Aa03225.1.p1e-102(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Liu Q, et al.
    The alteration in the architecture of a T-DNA insertion rice mutant osmtd1 is caused by up-regulation of MicroRNA156f.
    J Integr Plant Biol, 2015. 57(10): p. 819-29
    [PMID:25677853]