PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05144.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 217aa    MW: 24692.5 Da    PI: 9.7497
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05144.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.35.7e-30959151
                                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                    krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  Zmw_sc05144.1.g00030.1.sm.mkhc  9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTRGKLYEFAS 59
                                    79***********************************************86 PP

2K-box50.77.7e-1878162690
                           K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                                     ++++ +++ e+ + +++ L k++e L+  +R+llGe Le++s+ eL++Le +Leksl  +R +K + l+e+  +l+k +
  Zmw_sc05144.1.g00030.1.sm.mkhc  78 TNNTVQQDIEQIKADAEGLAKKLEALEAYKRKLLGERLEECSIDELHSLEVKLEKSLHIVRGRKVRKLKEEEMTLRKNN 156
                                     44467888999******************************************************************** PP

                           K-box  85 kelqee 90 
                                     ++l+e+
  Zmw_sc05144.1.g00030.1.sm.mkhc 157 EDLREK 162
                                     *99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.819161IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-33384IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-31323IPR002100Transcription factor, MADS-box
CDDcd002653.08E-42375No hitNo description
PfamPF003191.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.8E-1783163IPR002487Transcription factor, K-box
PROSITE profilePS5129711.48786169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009838Biological Processabscission
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFST RGKLYEFASA  60
SVQKTVERYR TYTKDNVTNN TVQQDIEQIK ADAEGLAKKL EALEAYKRKL LGERLEECSI  120
DELHSLEVKL EKSLHIVRGR KVRKLKEEEM TLRKNNEDLR EKCKVQPQLV APLGVVATQD  180
KHPEKAGNDM DVETELFIGL PGRDNRPSKA AIAVVEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D9e-20372271Myocyte-specific enhancer factor 2A
3mu6_C9e-20372271Myocyte-specific enhancer factor 2A
3mu6_B9e-20372271Myocyte-specific enhancer factor 2A
3mu6_A9e-20372271Myocyte-specific enhancer factor 2A
3p57_J2e-19372271Myocyte-specific enhancer factor 2A
3p57_I2e-19372271Myocyte-specific enhancer factor 2A
3p57_D2e-19372271Myocyte-specific enhancer factor 2A
3p57_C2e-19372271Myocyte-specific enhancer factor 2A
3p57_B2e-19372271Myocyte-specific enhancer factor 2A
3p57_A2e-19372271Myocyte-specific enhancer factor 2A
3kov_J2e-19372271Myocyte-specific enhancer factor 2A
3kov_I2e-19372271Myocyte-specific enhancer factor 2A
3kov_B2e-19372271Myocyte-specific enhancer factor 2A
3kov_A2e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985919.11e-120PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_004985920.11e-120PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_012698462.11e-120PREDICTED: MADS-box transcription factor 50 isoform X2
SwissprotQ9XJ601e-114MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLQ9FR851e-115Q9FR85_MAIZE; M5 protein
STRINGGRMZM2G171365_P011e-115(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379