PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05128.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 1244aa    MW: 134627 Da    PI: 9.9119
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05128.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.76.9e-18110144135
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                   C++C tt+Tp+WR+gp+g+ tLCnaCGl+y +k++
  Zmw_sc05128.1.g00010.1.am.mk 110 CTHCSTTETPQWREGPSGPGTLCNACGLHYNSKHR 144
                                   ******************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011413.27104139IPR000679Zinc finger, GATA-type
SMARTSM004011.9E-18104155IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-15106166No hitNo description
Gene3DG3DSA:3.30.50.101.6E-14108143IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.34E-18109166No hitNo description
PROSITE patternPS003440110135IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15110144IPR000679Zinc finger, GATA-type
Gene3DG3DSA:2.130.10.105.0E-53711728IPR015943WD40/YVTN repeat-like-containing domain
SMARTSM003203.0E-8762801IPR001680WD40 repeat
SuperFamilySSF509781.3E-47762804IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.105.0E-53762819IPR015943WD40/YVTN repeat-like-containing domain
PfamPF004004.4E-7767800IPR001680WD40 repeat
PROSITE profilePS5008215.187769802IPR001680WD40 repeat
PROSITE profilePS5029416.796769958IPR017986WD40-repeat-containing domain
PRINTSPR003206.1E-6788802IPR020472G-protein beta WD-40 repeat
Gene3DG3DSA:2.130.10.105.0E-538671109IPR015943WD40/YVTN repeat-like-containing domain
SMARTSM003202.0E-8869907IPR001680WD40 repeat
SuperFamilySSF509781.3E-478701056IPR017986WD40-repeat-containing domain
PfamPF004004.6E-7871907IPR001680WD40 repeat
PROSITE profilePS5008214.385876916IPR001680WD40 repeat
PROSITE patternPS006780894908IPR019775WD40 repeat, conserved site
PRINTSPR003206.1E-6894908IPR020472G-protein beta WD-40 repeat
SMARTSM003207.4E-9910949IPR001680WD40 repeat
PfamPF004000.0012913949IPR001680WD40 repeat
PROSITE profilePS5008212.781916950IPR001680WD40 repeat
PRINTSPR003206.1E-6936950IPR020472G-protein beta WD-40 repeat
SMARTSM0032016951990IPR001680WD40 repeat
SMARTSM003204.110031043IPR001680WD40 repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1244 aa     Download sequence    Send to blast
TAPKLPVHDA VPPATARASP SSGCALPTTG ETEPAPLLVS FSPLVADWVV PRKKRQLVTR  60
RNPTWLPKPE LYEAPPAEPP SAPSRRLEAG GSGNLPVVRR RRNRQRNRSC THCSTTETPQ  120
WREGPSGPGT LCNACGLHYN SKHRLLETYR PTKSPGFDSG KHSNRQSKAA KIMEKKAAAE  180
LLRLTADTAS ARPIGDEFVD VSTKAVHSTR RQGPGSCSGH SRPSHGATEV AAQPVLTRQL  240
CLESRATTRA VRRPSTDGQR LALAAARLYV VGDDGAGEPR RSGQGTLTRR RAGEAATTPS  300
VGDGGADKGV TCGLRSAAVP CSQAVAAACR LCRRVAHRSA TSFATTIQNT RVMSCKNGGD  360
LAAAVDDSHY HERDDHAKIR NMGDADSEEN ESCRDRERFF QCTDGEEPLG VELLEDAGTE  420
FPREEDDEDG DDVRVSFATA VGDRLWEEQA ELDLEVLDEE DEDVSRYDYG MWMATEPMSI  480
QERRRRLLHG MGLTSSWDLL RSRNARMRVP PNIPRSAPLR RPQPAAAFAV ADETTSTAAA  540
APAPAAASPV NGRRPPNASL RRCRSDSRLP VGCGVGRKPQ TFRRSFSLPH SMQGALPDHK  600
ARSPLPSAAL KDDGNGNVSH TRTRSGFKNL DNGKELMLND SQNGVQVSVD ELDRFMGYTP  660
LATQVIRRSQ SQPVSAAANG GANPGPKKRT RWLKNNKLVA SVARLINEKH KDSSTGGVRW  720
PSVATMSKSA SAHPAVSSCG TAGPPERLKV HHYGKASKEL TGLYIRQELR AHEGSIWTMK  780
FSPDARFLAT GGEDRVVRVW RVVDDADSAA AGVAQELGSA SVPPLPADTD GKSEAPGLAA  840
QLSKKLKGRS SKHVLPEHIV VPETVFALAE QPACSFDGHQ DDVLDLSWSK SQQLLSSSMD  900
KTVRLWDMDT QTCLKLFAHN DYVTCVQFNP VDDGYFISGS LDNKVRIWSV PERQVVDWSN  960
LNDMVTAACY TPDGQAAILG SHKGSCRFYK TTDCKLNQEA QIDMSISKKR KSQAKKITGF  1020
QFAPGNPSEI LVTSADSQIR VFNGITVLQK FKGTPATAAN PAPAFPSRGR QTDVTRREPV  1080
ARWHGGAEGG NAWGLVVVTA SRGGEIRVYQ NFGLPLGYRA TGIVPLDGVD EVPDAVAAAI  1140
EQRGQATRMR AKEKSTQVRG HEARGRAAEV TWARGLGDAS EPRRVHRDGR WSLARGQAPP  1200
ASRARGGEGW VRAREKEKDG HARGKARERG GVSGAGARDP RARG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5afu_32e-15772100761275DYNEIN TAIL
5afu_42e-15772100761275DYNEIN TAIL
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008679649.10.0PREDICTED: uncharacterized protein LOC103654584 isoform X2
TrEMBLK7U5770.0K7U577_MAIZE; Uncharacterized protein
STRINGGRMZM2G375856_P010.0(Zea mays)