PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05093.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 240aa    MW: 26291.5 Da    PI: 7.7814
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05093.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.84.2e-1776127455
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                                    kr rr+ +NRe+ArrsR+RK+a+++eLe  v++L++eN +L k+l e +++
  Zmw_sc05093.1.g00050.1.sm.mk  76 TKRIRRMVSNRESARRSRRRKQAQLAELESQVEQLKGENATLFKQLAEANQQ 127
                                   69*****************************************887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-1671137IPR004827Basic-leucine zipper domain
PfamPF001705.5E-1575127IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.43875127IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-1277129No hitNo description
Gene3DG3DSA:1.20.5.1705.1E-1477128No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MDGSSDDNLW WSGSIRTPEP ESSITAECQR ASVSAASPRG TSSTNHGHES QSDSDSESLI  60
DVEAIPCERR TKSLQTKRIR RMVSNRESAR RSRRRKQAQL AELESQVEQL KGENATLFKQ  120
LAEANQQFTT AVTDNRILKS DVEALRVKVK MAEDMVARSA MSCGLGDLGV APLMNSRKMC  180
QALGMLTVTG LDLLGRDACF RGPTPARQVQ NSPVQSTASL ESIDNRKSSE VTSCAVDMWP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18996RRSRRRKQ
29196SRRRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). May function as a negative regulator in cold and drought stress responses (PubMed:22189955). {ECO:0000269|PubMed:11133985, ECO:0000269|PubMed:22189955}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by cold stress in roots. {ECO:0000269|PubMed:22189955}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965642.11e-113bZIP transcription factor RISBZ5
SwissprotQ654B32e-86RSBZ5_ORYSJ; bZIP transcription factor RISBZ5
TrEMBLK3XZ621e-112K3XZ62_SETIT; Uncharacterized protein
STRINGPavir.Da00268.1.p1e-112(Panicum virgatum)
STRINGSi007043m1e-112(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Publications ? help Back to Top
  1. Onodera Y,Suzuki A,Wu CY,Washida H,Takaiwa F
    A rice functional transcriptional activator, RISBZ1, responsible for endosperm-specific expression of storage protein genes through GCN4 motif.
    J. Biol. Chem., 2001. 276(17): p. 14139-52
    [PMID:11133985]
  2. Liu C,Wu Y,Wang X
    bZIP transcription factor OsbZIP52/RISBZ5: a potential negative regulator of cold and drought stress response in rice.
    Planta, 2012. 235(6): p. 1157-69
    [PMID:22189955]