PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05050.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 434aa    MW: 46185.6 Da    PI: 9.7918
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05050.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-39195254261
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  Zmw_sc05050.1.g00040.1.am.mk 195 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRA 254
                                   7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-29193249IPR003851Zinc finger, Dof-type
PfamPF027015.2E-33196253IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.227199253IPR003851Zinc finger, Dof-type
PROSITE patternPS013610201237IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MRAGGGGRAG PKEPNQKPTR TGEGDGHGGP RMQARTTLLL RYASTATYIG ITRHAAGCCC  60
SPRPLDEGSE PFPSLLIHIS TPPRRRPHRT PTTTTATSSA SFRLAASSLQ FFSSAPKSIS  120
LNIRRRIEHR LTTKVDRSMM AGAPPMHICM DSDWFKGIVP EEPGMGSSSP STELIACPRQ  180
MHPAAAADRR LRPQHDQPLK CPRCESTHTK FCYYNNYSLS QPRYFCKTCR RYWTKGGSLR  240
NVPVGGGCRK NKRAGAKKPA APPLQAHARH MAETGLHLSF SSSGMQQLLP PPAAADPLCS  300
LGLLDWKYDP ILMGSAGGAA ALEGASSEAH FTGPGMMGMP GVGGECHALS ALRYAAGLGD  360
HLQAPPPPFG SSLAEHNGVE VKPAAAERLL SLEWYGTEAS RAPESAISSF GALGLWSGML  420
GGAHQQHHGS SAAI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953626.11e-165dof zinc finger protein 1
TrEMBLK3YUL61e-164K3YUL6_SETIT; Uncharacterized protein
STRINGSi017962m1e-165(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263