PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04958.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 574aa    MW: 61438.4 Da    PI: 6.6518
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04958.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.46.3e-13119180162
                                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                     e e+kr  r+ +NRe+A  sRqRKk+++eeLe  vk+++a   +L  +++  + e  +lk +
  Zmw_sc04958.1.g00010.1.sm.mkhc 119 EDEVKRRARLVRNRESAHLSRQRKKQYVEELEGTVKAMQATIADLSARISCVTAENVALKEQ 180
                                     6789******************************************9999988888888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.8E-13119183IPR004827Basic-leucine zipper domain
PfamPF001707.5E-12119180IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.553121181IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-13122181No hitNo description
Gene3DG3DSA:1.20.5.1702.4E-15123181No hitNo description
CDDcd147041.58E-19124174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MSEPSLLAPV AQDPFADLSF PELQVPPVDD TFAFEDFNLD DLDLDVDFDL DLFAADGQLS  60
QPPPLATSSS SAPSPERGSS SSSAGGDGGL RNEDSSESSS RSATGKDSCG KGKGDGAEED  120
EVKRRARLVR NRESAHLSRQ RKKQYVEELE GTVKAMQATI ADLSARISCV TAENVALKEQ  180
LGGAAGGAPP PLPMYPAVYP LPMPWVHPAY AMRGSQVPLV PIPRLKFQQP TPASEPPAKK  240
PRKTKKVASV SLLGLLCLVM VCGCLIPAVN RMYGTIDTGG GFAFGPSHHH GRVLAVEGPS  300
NSVLEGTDPK PPKNASETLP ALLYLPRNGK HVKINGNLVI KSIVASEEAS SRMSRYDEKS  360
HRSQRKEETS LAIPGNMAPL EAGEAVEPTA EVKNKLMALA PGDANMYRED DGLIPQWFSE  420
AMSGPMLSSG MCTEVFQFDV SPSSTHANGI VPVSSNSMAS SSQNFTENLP SGQPQKVKNR  480
RILYSGAIPL KGSTSNDTEH LKAHPKNETY ARSKPVPSMV VSILADPREA GDRSSDGRIS  540
SKSLSRIFVV VLIDSVKYVT YSCVLPFKNH SPHL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response. Acts as ER stress sensor and activates the transcription factor BZIP50 and the chaperone BIP1. {ECO:0000269|PubMed:22050533}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By dithiothreitol- and tunicamycin-induced endoplasmic reticulum (ER) stress response. {ECO:0000305|PubMed:22050533}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025800125.10.0bZIP transcription factor 60-like
SwissprotQ8LIB30.0BZP60_ORYSJ; bZIP transcription factor 60
TrEMBLA0A0K0K9Y40.0A0A0K0K9Y4_ELECO; BZIP transcription factor b
STRINGSb02g041070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Oono Y, et al.
    Analysis of ER stress in developing rice endosperm accumulating beta-amyloid peptide.
    Plant Biotechnol. J., 2010. 8(6): p. 691-718
    [PMID:20331531]
  3. Hu J, et al.
    The Bphi008a gene interacts with the ethylene pathway and transcriptionally regulates MAPK genes in the response of rice to brown planthopper feeding.
    Plant Physiol., 2011. 156(2): p. 856-72
    [PMID:21487048]
  4. Takahashi H,Kawakatsu T,Wakasa Y,Hayashi S,Takaiwa F
    A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response.
    Plant Cell Physiol., 2012. 53(1): p. 144-53
    [PMID:22084314]
  5. Ohta M, et al.
    Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.
    J. Exp. Bot., 2013. 64(18): p. 5429-41
    [PMID:24153418]
  6. Cheng Q, et al.
    An alternatively spliced heat shock transcription factor, OsHSFA2dI, functions in the heat stress-induced unfolded protein response in rice.
    Plant Biol (Stuttg), 2015. 17(2): p. 419-29
    [PMID:25255693]