PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04940.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 354aa    MW: 37647.1 Da    PI: 8.8124
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04940.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM44.83.8e-14139185148
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 
                                   lp+GfrFhPtdeel+ +yL++k+ + +l++ ++i+ +d+ +++PwdL 
  Zmw_sc04940.1.g00030.1.am.mk 139 LPVGFRFHPTDEELLLHYLRRKALACSLPA-DIIPVADLARLHPWDLV 185
                                   79****************************.99**************3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-17136187IPR003441NAC domain
PROSITE profilePS5100513.277139287IPR003441NAC domain
PfamPF023654.6E-7140192IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MNRGLDTGAA VQVHVLCRAG STVYQDRRHG MERDATHATP SVLFLYPARA PAVPSSSLHA  60
TDATAEACAS DSERHCTALV VLPLPQSTES SAAITDVRTS SPSCMLGGAG HRASRRCVAM  120
EARQAAGAAA AGGGALAGLP VGFRFHPTDE ELLLHYLRRK ALACSLPADI IPVADLARLH  180
PWDLVPPGAR RFLLYLSLAL KVMNCHGDGA AAGAEDWVVC RIFKRTKPGH GGRGGEEAEE  240
IPSFLFTKHL LPVPTARCCP PKHKNKVEAK GEQKGDDDKV FDAVTDWREA VVASDRYLSS  300
PRGSSLLLLL PPGGRRSIGG MGISFRVAGL IRSSCRCKAS PRLALSLPES NRSE
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2278446