PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04924.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 389aa    MW: 42017.2 Da    PI: 7.7072
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04924.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.11.8e-49101371128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGf+F P+deelv++yL+kkv+++++    ++ evd++  ePw+Lp  +k + +ewyfFs rd+kyatg+r+nra+k+g
  Zmw_sc04924.1.g00010.1.am.mk  10 LPPGFKFFPSDEELVCHYLHKKVANERIAQ-GTLVEVDLHAREPWELPDVAKLTASEWYFFSFRDRKYATGSRTNRAAKTG 89 
                                   79*************************998.88***************77777889************************* PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkd+ev s  ++++vg++ktLvfy+grap+g+k+ Wvmhe+rl
  Zmw_sc04924.1.g00010.1.am.mk  90 YWKATGKDREVRSPaTRAVVGMRKTLVFYHGRAPNGVKSGWVMHEFRL 137
                                   *************977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-587156IPR003441NAC domain
PROSITE profilePS5100557.29810156IPR003441NAC domain
PfamPF023651.8E-2611137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MALREIESTL PPGFKFFPSD EELVCHYLHK KVANERIAQG TLVEVDLHAR EPWELPDVAK  60
LTASEWYFFS FRDRKYATGS RTNRAAKTGY WKATGKDREV RSPATRAVVG MRKTLVFYHG  120
RAPNGVKSGW VMHEFRLDTP CSSPREDWVL CRVFEKTKGD GAADGHDSAS GASSSPTLTG  180
SSSHVDAPVR QEHHAPCGGY NGAGFAPQQE VAVLLPCYGS YGPPAVDRHG FPQDDAEGAL  240
PAGFEFGARE VAGDEYGFGY FDMAGFEYKL EPATYGLLAA VQRCRQRVTA WCGTPSSPPA  300
AYTCARPLAA GVKPPPPAVL TVPYEEPEPT PAAACSGCTW GLGNAVARSS SPVTDTKDGG  360
PREAAAALGQ AHRRSNAPRV LKHRAICFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-48715614165NO APICAL MERISTEM PROTEIN
1ut4_B1e-48715614165NO APICAL MERISTEM PROTEIN
1ut7_A1e-48715614165NO APICAL MERISTEM PROTEIN
1ut7_B1e-48715614165NO APICAL MERISTEM PROTEIN
3swm_A1e-48715617168NAC domain-containing protein 19
3swm_B1e-48715617168NAC domain-containing protein 19
3swm_C1e-48715617168NAC domain-containing protein 19
3swm_D1e-48715617168NAC domain-containing protein 19
3swp_A1e-48715617168NAC domain-containing protein 19
3swp_B1e-48715617168NAC domain-containing protein 19
3swp_C1e-48715617168NAC domain-containing protein 19
3swp_D1e-48715617168NAC domain-containing protein 19
4dul_A1e-48715614165NAC domain-containing protein 19
4dul_B1e-48715614165NAC domain-containing protein 19
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953145.11e-117NAC domain-containing protein 79
SwissprotQ9FLR32e-58NAC79_ARATH; NAC domain-containing protein 79
TrEMBLK3YUQ51e-116K3YUQ5_SETIT; Uncharacterized protein
STRINGSi018001m1e-117(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]