PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04858.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 296aa    MW: 33379.8 Da    PI: 7.5567
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04858.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-52191441128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtd+elv +yL++k++g++l++  +i+evd+yk++PwdLp+++  +++ewyfF++rd+ky++g+r+nra+ +g
  Zmw_sc04858.1.g00100.1.am.mk  19 LPPGFRFHPTDDELVEHYLCRKAAGQRLPV-PIIAEVDLYKFDPWDLPERALFGTREWYFFTPRDRKYPNGSRPNRAAGDG 98 
                                   79****************************.88***************8877899************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg dk+v   +g++ g+kk Lvfy g+ap+g+ktdW+mheyrl
  Zmw_sc04858.1.g00100.1.am.mk  99 YWKATGADKPVAP-RGRTLGIKKALVFYAGKAPRGVKTDWIMHEYRL 144
                                   ***********99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-6415171IPR003441NAC domain
PROSITE profilePS5100560.28719171IPR003441NAC domain
PfamPF023654.2E-2720144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MTMGTAVRRE RDAEAELNLP PGFRFHPTDD ELVEHYLCRK AAGQRLPVPI IAEVDLYKFD  60
PWDLPERALF GTREWYFFTP RDRKYPNGSR PNRAAGDGYW KATGADKPVA PRGRTLGIKK  120
ALVFYAGKAP RGVKTDWIMH EYRLADAGRA AAAKKGSLRL DDWVLCRLYN KKNEWEKMQM  180
KKAAAAATAA KEEAGDMTTY SHSQSWGETR TPESEILDND TFPTFLDPEA QMMAPKKEKV  240
DDAAAKNNLF VDLSYDDIQS MYNGLDMLPT PGEDFYSSLF ASLRVKGNQS AGMALF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-11261772174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that possesses transactivation activity (PubMed:16924117, PubMed:20632034). Transcription activator involved in response to abiotic stresses. Plays a positive role during dehydration and salt stress. Binds specifically to the 5'-CATGTG-3' motif found in promoters of stress-responsive genes (PubMed:16924117). {ECO:0000269|PubMed:16924117, ECO:0000269|PubMed:20632034}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stresss, salt stress and cold stress (PubMed:16924117, PubMed:20632034). Induced by abscisic acid (ABA) (PubMed:16924117). Induced by methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:16924117, ECO:0000269|PubMed:20632034}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466217.11e-174NAC domain-containing protein 67
SwissprotQ75HE51e-158NAC2_ORYSJ; NAC domain-containing protein 2
TrEMBLA0A191UR351e-176A0A191UR35_ELECO; NAC transcription factor
STRINGSb01g003710.11e-174(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  3. Chen Q,Wang Q,Xiong L,Lou Z
    A structural view of the conserved domain of rice stress-responsive NAC1.
    Protein Cell, 2011. 2(1): p. 55-63
    [PMID:21337010]