PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04657.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 96aa    MW: 10992.5 Da    PI: 6.2304
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04657.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind80.72.3e-253290260
                                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
                  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                                  Fl+k+y++++d+ +++++sw ++ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y
  Zmw_sc04657.1.g00080.1.am.mk 32 FLTKTYQLVDDPCTDHIVSWGDDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY 90
                                  9********************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.4E-272391IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004153.5E-222893IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467853.67E-233190IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.9E-213290IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.7E-163255IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.7E-167082IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.7E-168395IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MAFQLVERCG EMVVSTMESS AHAKPAPVPA PFLTKTYQLV DDPCTDHIVS WGDDDTTFVV  60
WRPPEFARDL LPNYFKHNNF SSFVRQLNTY VRKALV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A4e-1823961284Heat shock factor protein 1
5d5u_B4e-1823962193Heat shock factor protein 1
5d5v_B4e-1823962193Heat shock factor protein 1
5d5v_D4e-1823962193Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958473.11e-51PREDICTED: heat stress transcription factor B-4b-like
SwissprotQ7XHZ02e-50HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBLA0A096Q6758e-53A0A096Q675_MAIZE; Uncharacterized protein
TrEMBLK4A2Z12e-51K4A2Z1_SETIT; Uncharacterized protein
STRINGSi033243m4e-51(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394