PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04653.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 416aa    MW: 46411.1 Da    PI: 8.5694
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04653.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.8e-521232492128
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPtdeelv++yLk+k+++k++++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+
  Zmw_sc04653.1.g00020.1.am.mk 123 MPGFRFHPTDEELVSFYLKRKIQQKPISI-ELIRQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSLRPNRVTAAGF 202
                                   69***************************.89***************9888999*************************** PP

                           NAM  83 Wkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg+d++++s+ +++ +glkk+Lvfy+gra +g ktdW+mhe+rl
  Zmw_sc04653.1.g00020.1.am.mk 203 WKATGTDRPIYSSeGTKCIGLKKSLVFYQGRAARGMKTDWMMHEFRL 249
                                   ************956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.311122274IPR003441NAC domain
SuperFamilySSF1019412.09E-54122255IPR003441NAC domain
PfamPF023658.8E-26124249IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MRSQATESRG LLQPQSKGVN GVAGNWGDKR MEQSFQGVSD PLHGRNLCPP AIGGGKGSHL  60
GQNFRNDQTS QKQHAIIRSI KQAADCWSRL DQHRSGVKLF FTPLEDMEVK NDANMDKADE  120
IIMPGFRFHP TDEELVSFYL KRKIQQKPIS IELIRQLDIY KYDPWDLPKL ASTGEKEWYF  180
YCPRDRKYRN SLRPNRVTAA GFWKATGTDR PIYSSEGTKC IGLKKSLVFY QGRAARGMKT  240
DWMMHEFRLP SPTDPSLPKR PIDKNIPLNR GLSHSWGPPF PGATEAEFFS AFQTVQASEL  300
ALESSSCSLQ AAPPAGSSQF TSRHGLLVFG AQHDHQLNGF VVDSSAEVNG GTSSRSQDSS  360
AKKSSIGFSM SNSDWEAVGR INFPFDLGAD ASEEWRCNIP WESVLSPPAV QTELPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-4812425319146NO APICAL MERISTEM PROTEIN
1ut4_B5e-4812425319146NO APICAL MERISTEM PROTEIN
1ut7_A5e-4812425319146NO APICAL MERISTEM PROTEIN
1ut7_B5e-4812425319146NO APICAL MERISTEM PROTEIN
3swm_A6e-4812425322149NAC domain-containing protein 19
3swm_B6e-4812425322149NAC domain-containing protein 19
3swm_C6e-4812425322149NAC domain-containing protein 19
3swm_D6e-4812425322149NAC domain-containing protein 19
3swp_A6e-4812425322149NAC domain-containing protein 19
3swp_B6e-4812425322149NAC domain-containing protein 19
3swp_C6e-4812425322149NAC domain-containing protein 19
3swp_D6e-4812425322149NAC domain-containing protein 19
4dul_A5e-4812425319146NAC domain-containing protein 19
4dul_B5e-4812425319146NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022683500.10.0protein FEZ
TrEMBLA0A3L6PQ100.0A0A3L6PQ10_PANMI; Protein FEZ-like
STRINGSi015514m1e-179(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882