PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04569.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 341aa    MW: 37226.8 Da    PI: 10.7268
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04569.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind54.82.6e-172332831060
                                   HCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
                  HSF_DNA-bind  10 ledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                                   l++++ + +isw +  nsfvv+d+++fa+++Lp +Fkhsnf+SFvRQ n+Y
  Zmw_sc04569.1.g00030.1.am.mk 233 LHSRRWTGVISWGAAWNSFVVWDPSTFARDILPYHFKHSNFSSFVRQFNTY 283
                                   67788899******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004151.7E-5220312IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.104.3E-16233284IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467855.71E-14233283IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004472.6E-13234283IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MMQIQVVTPA CTASLPNSSY LPNDLLALSL PTRRKGWTEE KGRRVITGAE SAQRIGLVPT  60
RDVHARKGVI ALFSGGQRFD HLLIILATGT AAMRANLIYL LCYAFSGFRA KQMRGWPSGA  120
LLWLRHCVGS QQWGLRDHRP ASGSTPYTSP PQCGPPPPSH LHACLLTQGQ CPRRALPDWL  180
GLHGGAAGAQ ARGRGGAAAI VAGPFVPLDQ LIPRPGPDTP RPLQALLPGH SSLHSRRWTG  240
VISWGAAWNS FVVWDPSTFA RDILPYHFKH SNFSSFVRQF NTYVRAGQVS HSGTINLIWA  300
HIKALVADTI RELATLTTSS FHVGRWCSEF LDQAALLPDH P
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2786422