PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04490.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 466aa    MW: 50140.8 Da    PI: 9.8044
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04490.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-39225284261
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  Zmw_sc04490.1.g00060.1.am.mk 225 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRA 284
                                   7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-32223283IPR003851Zinc finger, Dof-type
PfamPF027015.8E-33226283IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.227229283IPR003851Zinc finger, Dof-type
PROSITE patternPS013610231267IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MHGSPPPIAV SFRFSSSSLS FHWSCMHGDQ NIPRGSTPPR LRRPDYALLR EGRVKAAGRQ  60
MGTHRDARRP AARDARNQSV GAHGTGEADE ERRGEWAVRS GPADTSPAST TLLLCSLSAS  120
TAPRELFRPF LFTPPPRPSF TSQIARQQPP PAAPPHHRLL PLLIRRSMMA GAPPMHIYMD  180
SDLFKGIIPE EPGLGSSSPS TELIVCPRQM HPAAAVADRR LRPQHDQPLK CPRCESTHTK  240
FCYYNNYSLS QPRYFCKTCR RYWTKGGSLR NVPVGGGCRK NKRANTKKQA AAAPPLLQGP  300
ARHVTETDLH LSFSSGMQQL PPTPASVDPL SSFGLLDWTW KYDPMLAGSA GGAAALDQSA  360
SSEAHFAGPG MTAGGGGECH ALSALRYAAG LGEHLQALPP LLRSSHAEND AVDVKPAATD  420
RLLSLEWYGE ASRAPESAIS SLGALGLWSG MFGGAHQQHP GSSAAI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001136632.11e-142Dof zinc finger protein DOF2.1
TrEMBLA0A0A9D8K81e-145A0A0A9D8K8_ARUDO; Uncharacterized protein
TrEMBLB6UAM81e-145B6UAM8_MAIZE; Uncharacterized protein
STRINGGRMZM2G140694_P011e-142(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263