PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04458.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 377aa    MW: 40162 Da    PI: 8.4903
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04458.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.82.7e-4283159278
                                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                     C vegC+adls+ +eyhrrhkvCe+hsk+pvv+v+g++qrfCqqCsrfh l efDe krsCr+rL++hn+rrrk+q+
  Zmw_sc04458.1.g00040.1.am.mkhc  83 CSVEGCTADLSKGREYHRRHKVCEAHSKTPVVVVAGQQQRFCQQCSRFHLLGEFDEIKRSCRKRLDGHNRRRRKPQP 159
                                     **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-3475144IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.18880157IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-4081162IPR004333Transcription factor, SBP-box
PfamPF031102.4E-3183156IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
LVAVLCRLLL MDWDTKMPSW DLGTVVGPSS GGGGGALDLK LGGPTSWKSA ATAAAVPPPP  60
PSSSSAPAKR PRSGQAHQAV PACSVEGCTA DLSKGREYHR RHKVCEAHSK TPVVVVAGQQ  120
QRFCQQCSRF HLLGEFDEIK RSCRKRLDGH NRRRRKPQPD PLNPGVLFAN HHGATRFASY  180
PQLFSAASMA DPKWPATMVK TETDAFHDHY VPAVHLNYGA SSRFNGKDWK HFPFLTPHGD  240
DAAAALGCQP FTITASSESS SSKQNNGHRA LSLLSDNQTP AQLMIPTAQP LGAALQYGDA  300
ARLPEDGDVS FTGMTYVSAG GKQASVLATP ACHPAVTASP GPATQLQYHG YGYHHVSGDD  360
QGDQDGAAIQ ALPFSSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2880156884squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139156KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814120.11e-166squamosa promoter-binding-like protein 2
SwissprotQ0JGI11e-120SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLA0A2T7DCF31e-165A0A2T7DCF3_9POAL; Uncharacterized protein
STRINGPavir.J02262.1.p1e-167(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]