PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04405.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 429aa    MW: 46590.3 Da    PI: 10.9375
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04405.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP699.4e-22351403153
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 
                                   +CqvegC  dl  akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsr+  ls
  Zmw_sc04405.1.g00080.1.am.mk 351 RCQVEGCGLDLGGAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRWVCLS 403
                                   6***********************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.2E-22345402IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.631349429IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-20350403IPR004333Transcription factor, SBP-box
PfamPF031106.6E-16352403IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MRALFDSRGP ESLSLSPCLL GVRWQLPVLK SVVQGVSYLS KTFLVAAAPC LLRLSFFFLL  60
RYTFFREDFL LHSSPLESFR REKERGVPVG SVALRPTERD PPCSDAVAGP PTNDSAPTAG  120
PCACRLFLPR APVRSRRRRP RSIAPATARR SLASHLGSAP SSNDSSLHGD AVAAAGRGRG  180
RPHPPTAFLM TLGLVCAPGE LFLLGRRGSC DRPGGFRKSR SRQCQLHGCT HRAFHQSQKL  240
IFNNARKTTP LPHHFFVISV TQQKDGALRT AHCSSLRSPN QPRIAQAESA MEWTVPKPAA  300
SPSSPPLLWD WGDSAAPASG SSGEAPARRG GKEREGKRAK GGEDGGGGEV RCQVEGCGLD  360
LGGAKEYHRK HRVCEAHTKC PRVVVAGQER RFCQQCSRWV CLSCCFQFPG RRSSAVDPCR  420
AAVSRLSRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A7e-14347399153squamosa promoter-binding protein-like 12
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4875223