PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04401.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 313aa    MW: 32984.9 Da    PI: 5.9415
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04401.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP59.68.1e-19185232148
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                                     +Cqv+gCead+ e+k yhrrh+vC  +++a++vl++g+++r+CqqC++
  Zmw_sc04401.1.g00010.1.sm.mkhc 185 RCQVPGCEADIRELKGYHRRHRVCLRCAHAAAVLLDGVQKRYCQQCGK 232
                                     6*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-17182235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.811183245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.29E-21184249IPR004333Transcription factor, SBP-box
PfamPF031102.3E-13186243IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MDAPYSGGGG VDAGEPVWDW GNLLDFVVQD DDSLVLPWDD VAGTGAAGPT EAGASLLATP  60
PPQPAEVEAN QEPEPEPEPV LPPLPLHVQG IGRRVRKRDP RLVCPNYLAG RVPCACPEVD  120
EMAAAAEVED VATELLAGAR KKVKTAGRRG KAGAVGGAGG SGGGVSTTGG GSGGGGRAVV  180
AAEMRCQVPG CEADIRELKG YHRRHRVCLR CAHAAAVLLD GVQKRYCQQC GKRKLERHNK  240
RRRRKPDSKV PFEKEMDEHL DLSADVSGDG ELREASVEAS SGAKQESVKL NNSPIHDLKT  300
AYSSSNSLDA YDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A6e-26185249584squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231243KRKLERHNKRRRR
2238245NKRRRRKP
3239244KRRRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656292.21e-114squamosa promoter-binding-like protein 9
SwissprotQ6I5761e-103SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A1D6FQB41e-119A0A1D6FQB4_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
STRINGGRMZM2G109354_P011e-116(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]