PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04378.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 690aa    MW: 75561.9 Da    PI: 9.1459
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04378.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.5e-10466518557
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                   kr +r   NR +A rs +RK  +++eLe+kv+ L++e ++L  +l  l+  +a
  Zmw_sc04378.1.g00030.1.am.mk 466 KRVKRVLANRQSAARSKERKMRYMAELEQKVQILQTEATTLSAQLTLLQRDSA 518
                                   899*****************************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-16462526IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576464527IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-9466518No hitNo description
SuperFamilySSF579598.44E-11466516No hitNo description
PfamPF001707.9E-9466518IPR004827Basic-leucine zipper domain
CDDcd147031.79E-22467518No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MAHVRSTQAL SDATSCSATE SHALRPSFSE IRTMMVQAYE QSNLLMHSAD RAGQLAHVRL  60
YKSGDVIGTT SSPPRTARIT CTPCACMTAW APRGFSPEES LSFPNRFLPH HRLLPPRFTF  120
PSSFNPRAWR RSLLCSSLFD SSSTPTRVDA EATEAVRAVN KQTEGQPNGA LKAPARAKHR  180
SIRFHRRPPR LHRQRQRSNG TSPPPPWSFR AAMNGAADAH AASLMQQELL QAARLQQQPP  240
QGMTSSMPTS NKPRLPGLPP TPPQRALDAC MDVDPAARNT AHRRSRSDVP FDYFPPPKVE  300
AGWGGGQDDA DDLFDSYLNL DGLDGVNNSS EERRDDGDSR GSSMKTNGAD SSENESEEGA  360
AADSRAAGIR LWAAGGVEGL NKRGGPGGQP GAAPAPRHAR SLSMDSLIGN GKFNFAAGGM  420
TSGANGIMPG PNRFSLEFGS GEFTPAEMKK IMADEKLAEM ALADPKRVKR VLANRQSAAR  480
SKERKMRYMA ELEQKVQILQ TEATTLSAQL TLLQRDSAGI ATQNSELQFR IRAMEQQAQL  540
RDAVFVNVRC AKHERRLAVV LDTCSLEKLY PAAGVDDDML ACPRPVRGGR MQVGSWWRLA  600
FREYTIASCA NTGSPLNEAL TAEVQRLKLA TAELGDSCSS NNLVQQIQLN VQEQMFQLQQ  660
QQQQQATPIP FYQLQHPQQS GAPENHEFKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796879.11e-139transcription factor RF2b-like
TrEMBLA0A2T7CI881e-140A0A2T7CI88_9POAL; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576