PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04320.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 211aa    MW: 22394.8 Da    PI: 8.9638
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04320.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.25.6e-381022011100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC++ Cv+apyfp ++++kfa vh++FGasnv+k+l+++p+  r da++sl+yeA+ar+rdPvyG+v+ il
  Zmw_sc04320.1.g00070.1.am.mk 102 PCAACKLLRRKCTQVCVFAPYFPPDNAAKFASVHEVFGASNVSKILNDVPQALRGDAANSLAYEADARIRDPVYGCVAYIL 182
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lq ++++ +a ++++ +e
  Zmw_sc04320.1.g00070.1.am.mk 183 ILQCKVKEISAGIDAASKE 201
                                   ********99988877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.264101202IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-38102197IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MSNGNDGSGG MYSPPALGPS AFDNNGASLS AVVGVAKRVV ILACCALVSR ERMLCLVDMK  60
PDGILLFPTN PSRARSGSPR AQPRYAPPPR GDRRSMSSSI SPCAACKLLR RKCTQVCVFA  120
PYFPPDNAAK FASVHEVFGA SNVSKILNDV PQALRGDAAN SLAYEADARI RDPVYGCVAY  180
ILILQCKVKE ISAGIDAASK ELDHLASRTS Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4010120210111LOB family transfactor Ramosa2.1
5ly0_B3e-4010120210111LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466819.12e-50LOB domain-containing protein 36
SwissprotQ9FKZ34e-44LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A287N9X43e-49A0A287N9X4_HORVV; Uncharacterized protein
TrEMBLA0A3B6HYL95e-49A0A3B6HYL9_WHEAT; Uncharacterized protein
TrEMBLA0A446R5Z55e-49A0A446R5Z5_TRITD; Uncharacterized protein
TrEMBLC5WSB65e-49C5WSB6_SORBI; Uncharacterized protein
STRINGSb01g014650.19e-50(Sorghum bicolor)
STRINGTraes_4AL_C060BF9F6.39e-50(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7523222
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]