PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04301.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family YABBY
Protein Properties Length: 143aa    MW: 16198.1 Da    PI: 9.7954
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04301.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY134.21.6e-413211191170
                           YABBY  91 sastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfg 169
                                     s+s++ +  ++ + e+ ++++   + rPPekrqrvPsaynrfikeei+rika+nPdishreafs+aaknWah+P+ihfg
  Zmw_sc04301.1.g00050.1.am.mkhc  32 SSSSKFQLPMMYSAENGHLQEHALATRPPEKRQRVPSAYNRFIKEEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFG 110
                                     4555666667777777777777789*****************************************************9 PP

                           YABBY 170 l 170
                                     l
  Zmw_sc04301.1.g00050.1.am.mkhc 111 L 111
                                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.0E-3929111IPR006780YABBY protein
SuperFamilySSF470959.43E-955105IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.0E-559105IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MWTLHQSTEN IRPQGIINGT SHDQFGHLEF GSSSSKFQLP MMYSAENGHL QEHALATRPP  60
EKRQRVPSAY NRFIKEEIRR IKANNPDISH REAFSTAAKN WAHYPNIHFG LSSPGREVGK  120
KLVDETVAAV TTPDPTNKIQ GFY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442565.11e-60hypothetical protein SORBIDRAFT_08g022030
SwissprotQ2QM173e-50YAB6_ORYSJ; Protein YABBY 6
TrEMBLA0A0A8Y1512e-70A0A0A8Y151_ARUDO; Uncharacterized protein
STRINGSb08g022030.14e-60(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121