PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04298.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 395aa    MW: 43258 Da    PI: 7.6799
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04298.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.15e-29154207358
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   ++rY+eC++NhAa+lG+h++DGC+Efmps +e   ++al CaACgCHR+FHRre +
  Zmw_sc04298.1.g00100.1.sm.mk 154 QWRYRECQRNHAARLGAHVLDGCCEFMPSANE--GPDALACAACGCHRSFHRREAV 207
                                   789*************************9555..59*****************986 PP

2Homeobox14.27.8e-05295351153
                                   TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                                   +r Rt+ft+eq +++ e+ +    + ++p+ ++     +++g++ r+ kvW +N + 
  Zmw_sc04298.1.g00100.1.sm.mk 295 KRFRTKFTAEQKDRMREFAHrvgwRIHKPDYDAVDAFCAEVGVSRRVLKVWMHNNKH 351
                                   789***********987655888779****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.2E-25155206IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.2E-24156205IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-15156205IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.448157205IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.608.2E-30286353IPR009057Homeodomain-like
SuperFamilySSF466891.7E-19288352IPR009057Homeodomain-like
TIGRFAMsTIGR015653.1E-27294350IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MEYKGSSHVE EEEDDMDEEE EEDDEEENRG QHYTTAPAAP VGAPQPQVVH GQAHGLLGSH  60
SSVTTESQSA AFSRPLLPPN SSLVSSQLPP PPGFLQPQRQ PQQAHPRKLE RGGGTQAQHQ  120
QVRLQQEPAR NGTTPTPPPA STLALTTGAV VQPQWRYREC QRNHAARLGA HVLDGCCEFM  180
PSANEGPDAL ACAACGCHRS FHRREAVHGV GATASVSPSP AMTPSANSSR VMPLLLAPPH  240
MRTRPHVPPX XXXSAPAALT ESSSEELRGS APARPLPPPQ LAVGSASAPP APSKKRFRTK  300
FTAEQKDRMR EFAHRVGWRI HKPDYDAVDA FCAEVGVSRR VLKVWMHNNK HLAKMPPHSP  360
SSSQQQPAPS HHHHHHHDHH HYPPPHQHHQ QQHNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-212933511674ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452677.11e-112hypothetical protein SORBIDRAFT_04g030480
SwissprotQ8S3Q98e-78ZHD7_ORYSJ; Zinc-finger homeodomain protein 7
TrEMBLA0A0A8Y4W61e-120A0A0A8Y4W6_ARUDO; Uncharacterized protein
STRINGSb04g030480.11e-111(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134912329