PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04232.1.g00080.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 623aa    MW: 68438.2 Da    PI: 9.0127
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat 221 VPPGFRFHPTEEELLNYYLRKKVASQEIDL-DVIRDVDLNKLEPWDIQEecKIGSgPQNDWYFFSHKDKKYPTGTRTNRAT 300
                                   69****************************.9***************953444443456********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   ++g+Wkatg+dk++++   + +g++ktLvfykgrap+g+k+dW+mheyrl 301 AAGFWKATGRDKAIYN-AVKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 349
                                   ****************.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-55215359IPR003441NAC domain
PROSITE profilePS5100554.903221407IPR003441NAC domain
PfamPF023659.1E-28222349IPR003441NAC domain
SuperFamilySSF1019412.35E-55395407IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-4421840817169NAC domain-containing protein 19
3swm_B4e-4421840817169NAC domain-containing protein 19
3swm_C4e-4421840817169NAC domain-containing protein 19
3swm_D4e-4421840817169NAC domain-containing protein 19
3swp_A4e-4421840817169NAC domain-containing protein 19
3swp_B4e-4421840817169NAC domain-containing protein 19
3swp_C4e-4421840817169NAC domain-containing protein 19
3swp_D4e-4421840817169NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140582.11e-166uncharacterized protein LOC100272652
SwissprotQ84WP61e-109NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A3L6F7521e-167A0A3L6F752_MAIZE; NAC domain-containing protein 43
STRINGPavir.J20698.1.p1e-166(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928