PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04225.1.g00030.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 357aa    MW: 39998 Da    PI: 11.5625
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                                    ++ +r+ +NRe+ArrsR+RK++++eeL  +v+ L+aeN + + ++ +   e +k++ 237 ERKRKRMLSNRESARRSRARKQQRLEELVAEVARLQAENAQVQARIATFDAELSKVDG 294
                                   46789999**********************************9999998888887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.7E-19234298IPR004827Basic-leucine zipper domain
Gene3DG3DSA: hitNo description
PROSITE profilePS5021711.656236299IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.06E-10238290No hitNo description
PfamPF001701.5E-10238291IPR004827Basic-leucine zipper domain
CDDcd147028.08E-7239283No hitNo description
PROSITE patternPS000360241256IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number