PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04183.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 698aa    MW: 74621.1 Da    PI: 10.0984
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04183.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.12.9e-30462514558
                   ZF-HD_dimer   5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   rY+eClkNhA  +GghavDGCgEfm++ geegt +al+CaAC+CHRnFHR+e+ 
  Zmw_sc04183.1.g00100.1.am.mk 462 RYRECLKNHALGIGGHAVDGCGEFMAA-GEEGTLDALRCAACNCHRNFHRKESP 514
                                   8*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-29445515IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-28462512IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.1E-28462513IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.647463512IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.05E-20596669IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-32600670IPR009057Homeodomain-like
TIGRFAMsTIGR015657.0E-26608664IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MPSAACDELT ATCSAPLTQR RFVHDLHARP NCEPFRWRFP GGAAPPPAID LIPSISCPPS  60
EKKKLFMHEL IITAGVAERH RLVSPPLRAL GKLRDSAPMA GLWMRRAFVL FHACPPCPPA  120
AAPVLRLCLL LMPWLHALLG PFAAASMHAY VTRLFSPSPA SLISAVAACV PFRRSAARPC  180
CWAGRFGAAV CVWIATNTMD VARSTASRHQ QRSGAGSQRK GTGCSPRTPP MDHRSRPMAT  240
SDRVSSQGKG IGGLAACGRQ RRLVLDPALT TSTSSGPSGH GDVPVHKWRD MTCRACRRGR  300
AGLNTCFGCE TPGCTDGVVM QNGPGLRTPE AYCPEPRALD RGAPGRDKTA AGTASARRGE  360
VACLRAPISD AFLFRWGDWT VDNTVNWTER TAVEALPAKI GPRRKNAISR PAACPVEPST  420
PAARETRQGG RQASSGFGGG VAPAKPPSEP GSRAKAPGGG GRYRECLKNH ALGIGGHAVD  480
GCGEFMAAGE EGTLDALRCA ACNCHRNFHR KESPTAEGSP VSPAAIVAYG ATPHQQFSPF  540
YRTPADYFHH QPHYMAPRPL ALPSTSHSGR DDGDDLSRMA GHVSALGPMS GMSLGAGPSG  600
SGGFGSGKKR FRTKFTQEQK DRMQAFAERV GWRIQKHDEA AVQQFCDEVG VKRHVLKVWM  660
HNNKHTLGKK PQHVAHPDPD PHCAHAPLNN AHAPSQSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-266096661875ZF-HD homeobox family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269