PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04105.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 356aa    MW: 37423.8 Da    PI: 7.1841
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04105.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.34.6e-10121183163
                                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                     eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke ++  +e+ +lk  +
  Zmw_sc04105.1.g00080.1.sm.mkhc 121 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNESMKKEKDMVMQEYLSLKEAN 183
                                     89**********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-6119186No hitNo description
SMARTSM003382.3E-12121185IPR004827Basic-leucine zipper domain
PfamPF001701.6E-8121184IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.082123186IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.78E-7125181No hitNo description
CDDcd147028.96E-13126176No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MSEDSDGQRP CRRGVNVHEL DAAMALADMA GVGPDQQQQQ QPQPPPAAPQ ADREDEELAS  60
TRLSLELGKV GIQSSPCSSS SSAGHHHAAP QQQQQQQPLM PAAAAVSGYG PRPRHMLTEA  120
EKEAKRLRRV LANRESARQT ILRRQAIRDE LARKVADLSS QNESMKKEKD MVMQEYLSLK  180
EANKQLKEQA DPSLSLSVAR TTKKAAAAAR VPVSTAAQVA APPTQQEAAI AASSPPTTPP  240
QPSFLYTAAP PAVPLPYDPL AAAAEPTSGG AGPAGAGTAE EDTDDDPCSL TLALDVDKRS  300
APIAIGSCGG GSRAATEAAG GEKGKAATAA EARKRRKELT KLKHMHADGR LGGEQW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1332337RKRRKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615785.11e-83uncharacterized protein LOC4349815
TrEMBLA0A3B6KDZ08e-90A0A3B6KDZ0_WHEAT; Uncharacterized protein
TrEMBLA0A446SWI28e-90A0A446SWI2_TRITD; Uncharacterized protein
STRINGPavir.Hb01810.1.p3e-84(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475