PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04076.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 715aa    MW: 77393.5 Da    PI: 7.6158
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04076.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind67.43.1e-2170129261
                                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
                  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 
                                   Fl+k+y+++++++l+  isw + gns+vv+d+++fa++vLp +Fkh+nf+ FvRQLn+Y 
  Zmw_sc04076.1.g00070.1.am.mk  70 FLSKTYDLVSEPALDGAISWGAAGNSIVVWDPSTFARDVLPYHFKHNNFSTFVRQLNTYS 129
                                   9**********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004156.0E-2466171IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.102.2E-2266129IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467857.35E-2068129IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004475.5E-1870129IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.9E-107093IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.9E-10108120IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.9E-10121133IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MNRNRANAPE YPTSSVSMEA LLEPKLEDEA ALPLSSPGPF VPLDQLMPGP GLDPPRPLEA  60
LLQGPQLPPF LSKTYDLVSE PALDGAISWG AAGNSIVVWD PSTFARDVLP YHFKHNNFST  120
FVRQLNTYSR GVDPVTGKLN PCHGTPRSSS LDPEHTLRRE KTALLQEVAR LKQEHRQTIE  180
HMSTLNQRLE SADDRQKQMI SFLAKLLQNP TFVRQLKLQR EQKEIDSTRV KRKYLKHVPH  240
GSIESGDMAD LQNFLLEEDD LIFGKNAENI GLEGFEAPED IGALVQGFNT QDELGSGAEL  300
LKTPPASSPL GQDPTIGRHK GKNVLCPGLD ATSSEAACLA SLGENTGLLS GTMLEPAAND  360
EQMWGIDTSA ALQSSCSGSS QQAYSSLASD PYLMEIVNKP EKFWDLDFQP LDEGDLPLDK  420
CPSDAVQAVN GTTCGAVSCM NVTAVPIIVA ATALPRSCAL RHPKPKAQTF SRAPIASPRG  480
EIGQGHRAAP NWTREAGGTR TGNAALAAPG QPVATRISYD EATAAAWCPR ASARDQPASH  540
LAEIRCVFRP VARRVSMPPL VPPAEQKRQR QEVRAAGAAV APREALAQRS ASFHGRGAAE  600
QQRQHHHLLR QKPRTQPDLL AGVRGQGVRR TGADANVPSA AGTARKAAPS KVLVAVAVQR  660
SMWPLHVMAR TEWRVADLVA AAVELYVKEG RRPLLPSADP SAFSLHYSQF SLQST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A6e-16621281178Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453922.10.0hypothetical protein SORBIDRAFT_04g021490
SwissprotQ6H6Q70.0HSFA3_ORYSJ; Heat stress transcription factor A-3
TrEMBLC5XTC90.0C5XTC9_SORBI; Putative uncharacterized protein Sb04g021490
STRINGSb04g021490.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90103041