PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04070.1.g00050.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 372aa    MW: 40324.5 Da    PI: 7.2427
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka..eekewyfFskrdkkyatgkrknra 77 
                                     lppGfrFhPtdeel+++yL++k+++ ++ + +++ e+d++++ePwdLp+++ a  ++kewyfF+ +d+ky+tg+r+nra  22 LPPGFRFHPTDEELITHYLARKAADPRFAA-QAVGEADLNRCEPWDLPARAGAtwGKKEWYFFCIKDRKYPTGQRTNRA 99 
                                     79*************************999.88***************6433334899********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     t+sgyWkatgkd+e+++ ++ lvg+kktLvfy+grapkg kt Wvmheyrle 100 TESGYWKATGKDREIFR-GKVLVGMKKTLVFYTGRAPKGGKTGWVMHEYRLE 150
                                     *****************.99******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-639184IPR003441NAC domain
PROSITE profilePS5100559.11722184IPR003441NAC domain
PfamPF023653.6E-2923149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_A6e-5491853166NAC domain-containing protein 19
4dul_B6e-5491853166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796322.11e-172NAC domain-containing protein 92-like
TrEMBLA0A3L6RW051e-174A0A3L6RW05_PANMI; NAC domain-containing protein 92-like
STRINGSi017567m1e-168(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number