PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04036.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 356aa    MW: 37582.6 Da    PI: 4.818
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04036.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.92.4e-14178238262
                                     XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                     ++ +r+ r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L ++++    e a+l+++
  Zmw_sc04036.1.g00020.1.sm.mkhc 178 EDPRRAARLMRNRESAQLSRQRKKRYVEELEEKVKSMHSVINDLNSRISFVMAENATLRQQ 238
                                     66789***********************************99******9999999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-16177241IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.933179239IPR004827Basic-leucine zipper domain
PfamPF001701.9E-12180238IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-15181239No hitNo description
SuperFamilySSF579593.56E-12181239No hitNo description
CDDcd147041.97E-19182233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MAEPALLDPS AFDLRHYPAH LFDPDLPMAG GGLPLGEFAG DGDCDGFDFD LPADFSVDDF  60
LLRSPDRGDD DDNSGEGSAA GSGPAPSSAA SPSTSAANSA VAHGEGEVKH EDSDEGRSGG  120
DAPASWSLKR KQASPELSTD GAKCRRSGDG ELSPSASALA SRAAAEGFDE RGTAGEEEDP  180
RRAARLMRNR ESAQLSRQRK KRYVEELEEK VKSMHSVIND LNSRISFVMA ENATLRQQMG  240
SGGGGSGPPP GVVYPPAPLP GMPFPWIPGY AMRPHGSHVP LVPIPRLKPQ QTASAAKVSK  300
KPEIKKSAEA RYLSPPGKDK NSQEASPADA PLPQWFREGM EGPILNSGMC SEILIT
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response. Acts as ER stress sensor and activates the transcription factor BZIP50 and the chaperone BIP1. {ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22084314}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by dithiothreitol- and tunicamycin-induced endoplasmic reticulum (ER) stress response. {ECO:0000269|PubMed:22084314}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148077.11e-139uncharacterized protein LOC100281685
SwissprotQ6AU901e-104BZP39_ORYSJ; bZIP transcription factor 39
TrEMBLA0A0A9JME21e-164A0A0A9JME2_ARUDO; Uncharacterized protein
STRINGGRMZM2G045236_P011e-139(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  3. Takahashi H,Kawakatsu T,Wakasa Y,Hayashi S,Takaiwa F
    A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response.
    Plant Cell Physiol., 2012. 53(1): p. 144-53
    [PMID:22084314]
  4. Ohta M, et al.
    Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.
    J. Exp. Bot., 2013. 64(18): p. 5429-41
    [PMID:24153418]
  5. Cheng Q, et al.
    An alternatively spliced heat shock transcription factor, OsHSFA2dI, functions in the heat stress-induced unfolded protein response in rice.
    Plant Biol (Stuttg), 2015. 17(2): p. 419-29
    [PMID:25255693]