PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04026.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LFY
Protein Properties Length: 470aa    MW: 51326.2 Da    PI: 9.3008
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04026.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY270.94.6e-83563291280
                       FLO_LFY   1 mdpea.fsas.lfkwd...praaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvs 76 
                                   mdp++ fsa+  f+wd   p++aa +pp         ++++l    a  a++ releel+ +yGvr +tva+i elGft+s
  Zmw_sc04026.1.g00060.1.am.mk  56 MDPHDaFSAAhPFRWDlgpPAHAAPHPPPPP----PPPPPSLPFPLAPPANAPRELEELVAGYGVRPSTVARILELGFTAS 132
                                   676554876659****653322222222222....222233345567778889**************************** PP

                       FLO_LFY  77 tLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqee 157
                                   tL++m+++eldd+m++l+ +fr+d+l+Ger+G++aa+raer r+ +      r      ++  +lda+sqe+ls+e++   
  Zmw_sc04026.1.g00060.1.am.mk 133 TLLGMTERELDDMMAALAGLFRWDVLLGERFGLRAALRAERARVVALG---GRF-----QTGGTLDAASQEVLSDERDVA- 204
                                   ********************************************9955...444.....46779***********98855. PP

                       FLO_LFY 158 keaagsggeglgeaelvaaeekkseeekkkaskk.kqkrkkkkelkse.....ededeeeeededeegsgedgeerqrehP 232
                                       +sgg    e++   a+ +k+ +++  ++k  k++rkk+ +         e +++    ++++e+s+ +g erqrehP
  Zmw_sc04026.1.g00060.1.am.mk 205 ----ASGGVADDETGRRLAAGRKQAKKEAATRKGkKARRKKELRPLDVledenEGDEDGGGASDSTESSAGGGGERQREHP 281
                                   ....4444443333333333322222222222221222222222222232222112222223334444667788******* PP

                       FLO_LFY 233 fivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtk 280
                                   f+vtepgevar+kknGLDYLf+LyeqCr fLlqvq+iak  G+k+Ptk
  Zmw_sc04026.1.g00060.1.am.mk 282 FVVTEPGEVARAKKNGLDYLFHLYEQCRVFLLQVQTIAKMGGHKSPTK 329
                                   ***********************************************9 PP

2FLO_LFY235.72.3e-72354460280386
                       FLO_LFY 280 kvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfn 360
                                    vtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenvGawrqacy+plv+iaar+g+didavf+
  Zmw_sc04026.1.g00060.1.am.mk 354 HVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENVGAWRQACYAPLVEIAARHGFDIDAVFA 434
                                   6******************************************************************************** PP

                       FLO_LFY 361 ahprLsiWYvPtkLrqLChlerskas 386
                                   ahprLsiWYvPt+LrqLCh++r+ ++
  Zmw_sc04026.1.g00060.1.am.mk 435 AHPRLSIWYVPTRLRQLCHQARNGHA 460
                                   **********************9775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016987.9E-18356460IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MRGTLARASS HTGTVRPSET NERGFVKSTG CARPAVRRTQ QWPLYNEPSP PAKATMDPHD  60
AFSAAHPFRW DLGPPAHAAP HPPPPPPPPP PSLPFPLAPP ANAPRELEEL VAGYGVRPST  120
VARILELGFT ASTLLGMTER ELDDMMAALA GLFRWDVLLG ERFGLRAALR AERARVVALG  180
GRFQTGGTLD AASQEVLSDE RDVAASGGVA DDETGRRLAA GRKQAKKEAA TRKGKKARRK  240
KELRPLDVLE DENEGDEDGG GASDSTESSA GGGGERQREH PFVVTEPGEV ARAKKNGLDY  300
LFHLYEQCRV FLLQVQTIAK MGGHKSPTKR QIGMHDMDAL SDSVVLCATP TYPHVTNQVF  360
RYAKKCGASY INKPKMRHYV HCYALHCLDE EASNALRRAY KARGENVGAW RQACYAPLVE  420
IAARHGFDID AVFAAHPRLS IWYVPTRLRQ LCHQARNGHA TAGLPPPPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A6e-952734572161PROTEIN LEAFY
2vy2_A6e-952734572161PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976675.10.0probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLK3YC120.0K3YC12_SETIT; Uncharacterized protein
STRINGSi011756m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649