PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04016.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 312aa    MW: 33992.8 Da    PI: 8.5628
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04016.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.38.9e-51131411128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknra 77 
                                     lppGfrFhP+d+elv++yL +kv+g+  ++  +  + +vd++kvePwdLp++++ + +ewyfFs +d+kyatg r+nra
  Zmw_sc04016.1.g00010.1.am.mkhc  13 LPPGFRFHPRDDELVCDYLGPKVRGTVgFSGRRPpVVDVDLNKVEPWDLPAEASVGPREWYFFSLKDRKYATGLRANRA 91 
                                     79***********************9986665656***************98889999********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     t sgyWkatgkd++v + +g lvg++ktLvfy+grapkg+kt+Wvmheyr+
  Zmw_sc04016.1.g00010.1.am.mkhc  92 TVSGYWKATGKDRAVAR-RGMLVGMRKTLVFYQGRAPKGRKTEWVMHEYRM 141
                                     ****************9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-582166IPR003441NAC domain
PROSITE profilePS5100555.55213166IPR003441NAC domain
PfamPF023651.2E-2614141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSMSFVSMVE AELPPGFRFH PRDDELVCDY LGPKVRGTVG FSGRRPPVVD VDLNKVEPWD  60
LPAEASVGPR EWYFFSLKDR KYATGLRANR ATVSGYWKAT GKDRAVARRG MLVGMRKTLV  120
FYQGRAPKGR KTEWVMHEYR MMEHEQSPKL SAKQEEDWVL CRVICKKTSA EGGATAKPAR  180
GLTINGYDTA TTTSPPLPAL MDTTLAQLQV AMNTTGAGAI EQVPCFSSFN NITSNSGGVA  240
SAAQPCYLPM ATSSNSMSYL GHGLPELSSC FGPLNSDEKL LKAVLSELGG GVMQSLSPDM  300
TAAASSTWMN HF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-51817112170NO APICAL MERISTEM PROTEIN
1ut4_B4e-51817112170NO APICAL MERISTEM PROTEIN
1ut7_A4e-51817112170NO APICAL MERISTEM PROTEIN
1ut7_B4e-51817112170NO APICAL MERISTEM PROTEIN
3swm_A5e-51817115173NAC domain-containing protein 19
3swm_B5e-51817115173NAC domain-containing protein 19
3swm_C5e-51817115173NAC domain-containing protein 19
3swm_D5e-51817115173NAC domain-containing protein 19
3swp_A5e-51817115173NAC domain-containing protein 19
3swp_B5e-51817115173NAC domain-containing protein 19
3swp_C5e-51817115173NAC domain-containing protein 19
3swp_D5e-51817115173NAC domain-containing protein 19
4dul_A4e-51817112170NAC domain-containing protein 19
4dul_B4e-51817112170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805880.11e-171NAC domain-containing protein 21/22-like
SwissprotQ84TE68e-80NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A2T7EJ771e-170A0A2T7EJ77_9POAL; Uncharacterized protein
STRINGSi022747m1e-154(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100223144
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]